triangle PDBeMotif: 1hrn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification hydrolase/hydrolase inhibitor    | release date: Fri, Mar 31, 1995
Title high resolution crystal structures of recombinant human reni complex with polyhydroxymonoamide inhibitors
Authors L.TONG, P.C.ANDERSON
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search 03D 03D binding statistics 03D
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRY
STGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYN
RDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLM
EALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKF
YTEFDRRNNRIGFALAR
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  03D 391A  ..               *                  * *                                          ***                                ** ** *  *                                         ..03D ..                                                     * * ***                                                                          *        *                          
JMol viewer RasMol script viewer  NAG 367A  ..               |                  | |                                  *       |||                                || || |  |                                         ..NAG ..                                                     | | |||                                                                          |        |                          
sec str:  ......eeeeeeee...eeeeeeee....eeeeeeee......eee........hhhh......hhh.........eeeeee..eeeeeeeeeeeeee..eeeeeeeeeeeee.hhhhhh....eeee...hhh.hhh...hhhhhhhh......eeeeee......... .....eeeee....hhh.....eeee.......eeeeeeeee..eeee....eeeee......eee.hhhhhhhhhhh.........eeehhhhhh...eeeee..eeeee.hhhh..........eee..eee..........eee.hhhh..eeeeee....eeeeee..
sequence :  ..GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSEN... ..SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..-2        8         18        28        38        46        56        66        76        86        96        107       117       127       137       147       157  ... ..160       170       180       190       200       210       220       230       240       251       261       271       279       287       297       307       317       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|^***|     | |||            | ||  |||| |  | | ||| ||| ||||   ||| | ||| ^*** ||||  |    |         |    |     || | | |  | |       || ||           | ||||               ..PS00001..           |||||          |  |      |    |  || |    |  || |    || | ||  || |||         |  || || |            | ||||   | | |             |  |         |  | |  || |||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |     | |||            ^**|  |||| |  | ^**|| ||| ||||   ||| | ^** |||  ^**|  |    |         |    |     || | | |  | |       || ||           | ||||               ..PS00005..           |||||          |  |      |    |  || |    |  || |    || | ||  || |||         |  || || |            | ||||   | ^**             |  |         |  | |  || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     | |||               |  |||| |  | | ||| ||| ||||   ||| | ||  |||   | |  |    |         |    |     || | | |  | |       || ||           | ||||               ..PS00006..           |||||          |  |      |    |  || |    |  || |    || ^***  || |||         |  || ^***            ^***||   | | |             |  |         |  | ^***| |||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     | |||               |  |||| |  | | ||| ||| ||||   ||| | ||  |^***** |  ^*****         ^*****     || | | |  | |       || ||           | ||||               ..PS00008..           |||||          |  |      ^*****  || |    |  || |    ^*****   || |||         |  ||  |              | ||||   | | |             |  |         |  |    || |||       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..           | |||               ***^******** | ||| ||| ||||   ||| | ||  | |     |                            || | | |  | |       || ||           | ||||               ..PS00141..           |||||          |  |              || |    ***^********|   |   || |||         |  ||  |              | ||||   | | |             |  |         |  |    || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |||                  |||| |    | ||| ||*****|   ||| | ||  | |     |                            || | | |  | |       || ||           | ||||               ..alphabetamotif..           |||||          |  |              || |       || |     |   |   || |||         *****  |              *****|   | | |             |  |         |  |    || |||       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |||                  |||| |    | ||| ||| || |   ||| | ||  | |     |                            || | | |  | |       || ||           | ||||               ..asxmotif..           *****          |  |              || |       || |     |   |   || |||         |  ||  |              | || |   | | |             |  |         |  |    || |||       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |||                  ***| |    | ||| ||| || |   *** | ||  ***     |                            || | | |  | |       || ||           | ||||               ..asxturn..           ***||          |  |              || |       || |     |   |   || |||         |  ||  |              | || |   | | |             |  |         |  |    || |||       
search RasMol script viewer Motif-ligand binding stats  betabulge ..           | |||                  || | |    | ||| ||| || |    |  | ||  | |     |                            ** | | |  | |       || ||           | ||||               ..betabulge..           || ||          |  |              ** |       || |     |   |   || |||         |  ||  |              | || |   | | |             |  |         |  |    || |||       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****|                  || | |    ****| ||**** |    **** ||  | |     |                               | | |  | |       *****           ****||               ..betaturn..           ****|          |  |              |  |       || |     |   |   |****|         ****|  |              **** |   | | |             |  |         |  |    |****|       
search RasMol script viewer Motif-ligand binding stats  nest ..             ***                  || | |    | ||| ||  |  |    |  | ||  ***     |                               | | |  | |        |  |             ****               ..nest..            |  |          |  |              |  |       || |     |   |   |  ***             |  |                |  |   | | |             |  |         |  |    |  ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ******    ********  ****    *******          |                               *** ******        ****              ***               ..niche..            ****          ****              ****       ****     |   |   |    |             ****                ****   *** |             ****         ****    |    |       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  || |      | | | |              | |           |                                                                                     ..schellmannloop..                                                       ||       |   |   ******                                        | | |                                  ******       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  || |      ***** |              | |           |                                                                                     ..stmotif..                                                       ||       *****                                                 | | |                                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  || |      *** ***              ***           |                                                                                     ..stturn..                                                       ||                                                             *****                                               
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                  ** *                                         *                                                                                     ..REP00000..                                                       **                                                                                                                 

chain B : RENIN
member of: CATH:search2.40.70.10GENE3D:searchG3DSA_2.40.70.10PANTHER:searchPTHR13683/searchPTHR13683_SF77PFAM:searchPF00026PRINTS:searchPEPSINPROSITE PATTERNS:searchPS00141, SUPERFAMILY:searchSSF50630UniProt:searchP00797
JMol viewer RasMol script viewer  NAG 367B  ..                                                                       * *                             *                                                            ..NAG ..                                                                                                                                                                          
JMol viewer RasMol script viewer  03D 391B  ..               *                  * *                                  | |     ***                     |          *  ** *                                           ..03D ..                                                     * * ***                                                                        * *                                   
sec str:  ......eeeeeeee...eeeeeeee....eeeeeeee......eee........hhhhh.....hhh.........eeeee....eeeeeeeeeeeee..eeeeeeeeee....hhhhhh....eeee...hhh.hhh...hhhhhhhh......eeeeee........ .....eeeee....hhh.....eeee.......eeee..eee..eeee....eeeee......eee.hhhhhhhhhhh..eee..eeeeehhhhhh...eeeee..eeeee.hhhh..........eee..eee..........eee.hhhhhheeeeee....eeeeee..
sequence :  ..GNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSE... ..SLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
seq num:  ..-2        8         18        28        38        46        56        66        76        86        96        107       117       127       137       147       157 ... ..160       170       180       190       200       210       220       230       240       251       261       271       279       287       297       307       317       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|^***|     | |||            | ||  || | |  | | ||| |   |  |   ||||| ||| ^*** ||||  |    |        |||   |           || ||          |  |           |  | |              ..PS00001..            |  |          |  |      |    |    | |   |  || |    || | ||     | |             | || |    |  |    | ||||     | ||            |  |         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|    |     | |||            ^**|  || | |  | ^**|| |   |  |   ||||| ^**  |   ^**|  |    |        |||   |           || ||          |  |           |  | |              ..PS00005..            |  |          |  |      |    |    | |   |  || |    || | ||     | |             | || |    |  |    | ||||     ^**|            |  |         |  | |  |  | |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|    |     | |||               |  || | |  | |  || |   |  |   ||||| ||   |    | |  |    |        |||   |           || ||          |  |           |  | |              ..PS00006..            |  |          |  |      |    |    | |   |  || |    || ^***     | |             | ^***    |  |    ^***||     |  |            |  |         |  | ^***  | |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..^*****     | |||               |  || | |  | |  || |   |  |   ||||| ||   ^***** |  ^*****        |^*****           || ||          |  |           |  | |              ..PS00008..            |  |          |  |      ^*****    | |   |  || |    ^*****      | |             |  |      |  |    | ||||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  ASP_PROTEASE ..           | |||               ***^******** |  || |   |  |   ||||| ||          |                | |               || ||          |  |           |  | |              ..PS00141..            |  |          |  |                | |   ***^********|   |      | |             |  |      |  |    | ||||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..           | |||                  || | |    |  || |   |  |   ||||| ||          |                | |               || ||          |  |           |  | |              ..alphabetamotif..            |  |          |  |                | |      || |     |   |      | |             |  |      |  |    *****|     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..           | |||                  || | |    |  || |   |  |   ***** ||          |                | |               || ||          |  |           |  | |              ..asxmotif..            |  |          |  |                | |      || |     |   |      | |             |  |      |  |    | ||||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  asxturn ..           | |||                  || | |    |  || |   |  |   ***|| ||          |                | |               || ||          |  |           |  | |              ..asxturn..            |  |          |  |                | |      || |     |   |      | |             |  |      |  |    | ||||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..           *****                  || | |    |  || |   |  |   || || ||          |                | |               || ||          |  |           |  | |              ..betabulgeloop..            |  |          |  |                | |      || |     |   |      | |             |  |      |  |    | ||||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  betaturn ..           ****|                  || | |    |  || |   ****   ***** ||          |                | |               ****|          ****           **** |              ..betaturn..            |  |          |  |                | |      || |     |   |      | |             |  |      ****    ****||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |                  || | |    |  || |   |  |    |  | ||          |                | |                |  |          |  |              ***              ..gammaturn..            |  |          |  |                | |      || |     |   |      | |             |  |              | | ||     |  |            |  |         |  |       | |       
search RasMol script viewer Motif-ligand binding stats  nest ..             ***                  || | |    |  || |   |  |    |  | ||          |                | |                |  |          |  |                               ..nest..            |  |          |  |                ***      || |     |   |      ***             |  |              | | ||     |  |            |  |         |  |       ***       
search RasMol script viewer Motif-ligand binding stats  niche ..                                  ******    ****| |   ****    *******          |                ***                ****          ****                               ..niche..            ****          ****                         ****     |   |                      ****              | ****     ****            ****         ****                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                  || |          | |              | |           |                                                                                    ..stmotif..                                                       ||       *****                                        *****                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                  || |          ***              ***           |                                                                                    ..stturn..                                                       ||                                                    ***                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                  ** *                                         *                                                                                    ..REP00000..                                                       **                                                                                                                 

   New search    1hrn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML