triangle PDBeMotif: 1hov  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.24.24
Classification hydrolase/hydrolase inhibitor    | release date: Mon, Dec 11, 2000
Title solution structure of a catalytic domain of mmp-2 complexed with sc-74020
Authors A.M.STEVENS, C.P.HOWARD, D.WELSCH, G.A.DE CRESCENZO, G.MUNIE, H.-S.SHIEH, H.WOODWARD, J.J.LIKOS, J.J.MCDONALD, L.ZHU, W.C.STALLINGS, Y.FENG
Method SOLUTION NMR
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search CA CA binding statistics CA   search I52 I52 binding statistics I52
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKD
GLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQE
LYG
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                *****                              *   **  *     *     ** * *** *  **              
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                    |||||      * ***                   |   ||  |     |     || | ||| |  ||              
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ****|*|||      | |||   *  *            |   ||  |     |     || | ||| |  ||              
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                |||||||||      | |||   |  |            |   *|  *     |     || | ||| |  ||              
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    ||||||||*      | ||| * |  |            |   ||  |     |     || | ||| |  ||              
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |  | | |      | |           |  ||   | ||||  | |         | |       | |                  ||||||||  || |   ^***^*** || |||||| ||   |||  |  |           |  | |  |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |  | | |      ^**           |  ||   | ||||  | |         | |       | |                  ||||||||  || |         |  || |||||| ||   |||  |  |           |  | |  |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..| |  | | |                    ^***|   | ||||  | |         | |       | |                  |||||||^***| |         |  || |||||| ||   |||  |  |           ^*** |  |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |  | | |                    |  ||   | ||||  | |         | |       | |                  ^*****|    | |         |  || |||||| |^*****|  |  |                |  |  | 
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..| |  | | |                    |  ||   | ||||  | |         | |       | |                   |||| |    | |         |  |***^^**^**    | |  |  |                |  |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..| |  | | |                    *****   *****|  | |         | |       | |                   |||| |    | |         |  |  ******      | |  |  |                |  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..| |  | | |                    ****    ******  | |         | |       | |                   |||| |    | |         ****  *****       | |  |  |                ******* 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***  *****                                    ***         | |       ***                   ***| |    ***                  |        | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..                                                          | |                              ||| |                         |        ***  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                          ***                              *****                         |          *******                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                 ****                              **  **  *     *     ** ***** *  *               
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                     ||||      * * *                   ||  ||  |     |     || ||||| |  |               
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** * *|||      | | |      *            ||  ||  |     |     || ||||| |  |               
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || | ||||      | | |      |            ||  *|  *     |     || ||||| |  |               
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || | |||*      | | | *    |            ||  ||  |     |     || ||||| |  |               
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                | |           |  ||| ||||| || |                    | | |                 | ||||||  |      ^***^***||| |||||| |||  |||  |  |           |  | |  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                ^**           |  ||| ||||| || |                    | | |                 | ||||||  |        | | | ||| |||||| |||  |||  |  |           |  | |  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                              ^***|| ||||| || |                    | | |                 | |||||^***        | | | ||| |||||| |||  |||  |  |           ^*** |  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                              |  ||| ||||| || |                    | | |                 ^*****|            | | | ||| |||||| |^*****|  |  |                |  ||   
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..                              |  ||| ||||| || |                    | | |                   ||| |            | | | ||***^^**^**||  | |  |  |                |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                              *************** |                    | | |                   ||| |            | | | ||  *********|  | |  |  |                *****   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              **** ************                    | | |                   ||| |            | | | |************|  | |  |  |                ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                                   *** |                   ||| |            | | | |      |   | |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..                                                                     ***                   ||| |            *** | |      |   ***  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                           *****                | |      |        ***  ****                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                ***      |                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                  ***                              *   **  *     *     ** ****  *                  
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                      |||      * * *                   |   ||  |     |     || ||||  |                  
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** * *|||      | | |   *  *            |   ||  |     |     || ||||  |                  
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || | ||||      | | |   |  |            |   *|  *     *     || ||||  |                  
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || | |||*      | | | * |  |            |   ||  |     |     || ||||  |                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |   | |      | |    | |   || ||||||||||||  |                                          | | || |  |      ^***^***  |  ||||| ||    ||  |  |           || |||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |   | |      ^**    | |   || ||||||||||||  |                                          | | || |  |        | |     |  ||||| ||    ||  |  |           || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |   | |             | |   |^***||||||||||  |                                          | | || ^***        | |     |  ||||| ||    ||  |  |           ^***||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   | |             | |   || ||||||||||||  |                                          ^*****             | |     |  ||||| |^*****|  |  |           || |||       
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE .. | |   | |             | |   || ||||||||||||  |                                            | |              | |     ***^^**^**|     |  |  |           || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   | |             | |   ************|||  |                                            | |              | |        ***** ||     |  |  |           ******       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |   | |             | |   ******************                                            | |              | |        ********     |  |  |           *****        
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |   ***             | |                                                                 | |              | |          |          |  |  |                        
search RasMol script viewer Motif-ligand binding stats  nest .. | |                   | |                                                                 | |              ***          |          |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche .. ***                   | |                                                                 ***                           |          *******                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                                                               |                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                * ***                              *   **  *     *     ** * *** *    *             
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                    | |||      * **                    |   ||  |     |     || | ||| |    |             
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** *|*|||      | ||    *  *            |   ||  |     |     || | ||| |    |             
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || ||||||      | ||    |  |            |   *|  *     *     || | ||| |    |             
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || |||||*      | ||  * |  |            |   ||  |     |     || | ||| |    |             
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |      | |    | |    || || |||  ||| || |                                        | | || |  |      ^***^*** || |||||| ||   |||  |  |      | |  || |||       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |      ^**    | |    || || |||  ||| || |                                        | | || |  |            |  || |||||| ||   |||  |  |      | |  || |||       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |             | |    ^***| |||  ||| || |                                        | | || ^***            |  || |||||| ||   |||  |  |      | |  ^***||       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |             | |    || || |||  ||| || |                                        ^*****                 |  || |||||| |^*****|  |  |      | |  || |||       
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..       | |             | |    || || |||  ||| || |                                          | |                  |  |***^^**^**    | |  |  |      | |  || |||       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |             | |    *************| || |                                          | |                  |  |  ****** |    | |  |  |      | |  ******       
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |             | |    ******* ********* |                                          | |                  ****  ********    | |  |  |      | |  *****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***             | |                    | |                                          | |                           |        | |  |  |      ***               
search RasMol script viewer Motif-ligand binding stats  niche ..                       | |                    ***                                          ***                           |        | *******                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                    ***                                                                        |        ***                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                         *                                        ***                             **  ***  *     *      * *******                  
JMol viewer RasMol script viewer  CA 168A  ..                                         |                 *                      |||      * * *                  ||  |||  |     |      | |||||||                  
JMol viewer RasMol script viewer  CA 167A  ..                                         |                 |                **** *|||      | | |   *  *           ||  |||  |     |      | |||||||                  
JMol viewer RasMol script viewer  ZN 166A  ..                                         |                 |                |||| ||||      | | |   |  |           ||  |*|  *     *      | |||||||                  
JMol viewer RasMol script viewer  ZN 165A  ..                                         |                 |         * *    |||| |||*      | | | * |  |           ||  |||  |     |      | |||||||                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |   | |  ||||| |           || ||  || ||||  |                                          |    | |  |  |   ^***^***  | |||||| ||   |||  |  |           |  | |  ||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |   | |  ||||^**           || ||  || ||||  |                                          |    | |  |  |     | |     | |||||| ||   |||  |  |           |  | |  ||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |   | |  ||||              ^***|  || ||||  |                                          |    | ^***  |     | |     | |||||| ||   |||  |  |           ^*** |  ||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |   | |  ||||              || ||  || ||||  |                                          ^*****    |  |     | |     | |||||| |^*****|  |  |                |  ||   
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE .. | |   | |  ||||              || ||  || ||||  |                                                    |  |     | |     ***^^**^**    | |  |  |                |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |   | |  ||||              *****  ******|  |                                                    |  |     | |       ******      | |  |  |                *****   
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |   | |  ||||              *****  ***** ****                                                    |  |     | |       *****       | |  |  |                ****    
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |   ***  ****                                                                                   |  |     ***          |        | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche .. ***                                                                                               ****                  |        | *******                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                         |        ***                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                * ***                              *   **  *     *     ** ***** *                  
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                    | |||      * * *                   |   ||  |     |     || ||||| |                  
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** *|*|||      | | |   *  *            |   ||  |     |     || ||||| |                  
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || ||||||      | | |   |  |            |   *|  *     *     || ||||| |                  
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || |||||*      | | | * |  |            |   ||  |     |     || ||||| |                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |  | | | |           |  || |||||| |  | |     | |         | | ||||               |    | |  |     |^***^***  |||||||| ||    ||  |  |      | |  |  || || ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  | | ^**           |  || |||||| |  | |     | |         | | ||||               |    | |  |     | ||    |  |||||||| ||    ||  |  |      | |  |  || || ||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  | |               ^***| |||||| |  | |     | |         | | ||||               |    | ^***     | ||    |  |||||||| ||    ||  |  |      | |  ^***| || ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  | |               |  || |||||| |  | |     | |         | | ||||               ^*****          | ||    |  |||||||| |^*****|  |  |      | |  |  || || ||  
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..       | |  | |               |  || |||||| |  | |     | |         | | ||||                               | ||    |  ***^^**^**      |  |  |      | |  |  || || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |  | |               ***********| |  | |     | |         | | ||||                               | ||    *****|  ||  |      |  |  |      | |  ***** || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  | |               ************ |  | |     | |         | | ||||                               ****    **** ********      |  |  |      | |  ****  *****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***  ***                            |  ***     ***         *** ||||                               | |             |          |  |  |      ***               
search RasMol script viewer Motif-ligand binding stats  nest ..                                           |  |                       ****                               ***             |          |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                           ****                                                                          |          *******                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                  ***                              *   **  *     *     ** * *** *                  
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                      |||      * * *                   |   ||  |     |     || | ||| |                  
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** * *|||      | | |   *  *            |   ||  |     |     || | ||| |                  
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || | ||||      | | |   |  |            |   *|  *     *     || | ||| |                  
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || | |||*      | | | * |  |            |   ||  |     |     || | ||| |                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | || |    | |    |  |    |  | |  |                     | |    | |           |    | |  |      ^***^***  | |||||| ||    ||  |  |         | |  ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |^**    | |    |  |    |  | |  |                     | |    | |           |    | |  |        | |     | |||||| ||    ||  |  |         | |  ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             | |       | |    ^***    |  | |  |                     | |    | |           |    | ^***        | |     | |||||| ||    ||  |  |         | ^***|        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |       | |            |  | |  |                     | |    | |           ^*****             | |     | |||||| |^*****|  |  |         | |  ||        
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..             | |       | |            |  | |  |                     | |    | |                              | |     ***^^**^**      |  |  |         | |  ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             | |       | |            |  | |  |                     | |    | |                              | |       ******        |  |  |         | *****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |       | |            **** ****                     | |    | |                              | |       *****         |  |  |         | ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ***       | |                                          ***    ***                              ***          |          |  |  |         | |            
search RasMol script viewer Motif-ligand binding stats  nest ..                       | |                                                                                               |          |  |  |         ***            
search RasMol script viewer Motif-ligand binding stats  niche ..                       | |                                                                                               |          *******                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                                                               |                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                 ***                               *   **  *     *      *   *** *                  
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                     |||       *** *                   |   ||  |     |      |   ||| |                  
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** * *||       ||| |   *  *            |   ||  |     |      |   ||| |                  
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || | |||       ||| |   |  |            |   *|  *     *      |   ||| |                  
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || | |||*      ||| | * |  |            |   ||  |     |      |   ||| |                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | | | | |  | | | |    | |    || || |||  ||| || |      | |                               || |||||  |  |   ^***^*** || |||||| |||  |||  |  |     | |   | || | |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | | | | |  | | ^**    | |    || || |||  ||| || |      | |                               || |||||  |  |         |  || |||||| |||  |||  |  |     | |   | || | |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | | | | |  | |        | |    ^***| |||  ||| || |      | |                               || ||||^***  |         |  || |||||| |||  |||  |  |     | |   ^*** | |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | | | | |  | |        | |    || || |||  ||| || |      | |                               ^*****|   |  |         |  || |||||| |^*****|  |  |     | |     |  | |  |  
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE .. | | | | |  | |        | |    || || |||  ||| || |      | |                                | || |   |  |         |  |***^^**^**||  | |  |  |     | |     |  | |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | | | | |  | |        | |    *************| || |      | |                                | || |   |  |         ***** *****| |||  | |  |  |     | |     |  | |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | | | | |  | |        | |    ******* ********* |      | |                                ******   |  |         ****  **** ****|  | |  |  |     | |     **** ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | | | ***  | |        | |                ||  | |      ***                                | || |   |  |                  |   | |  | |  |  |     | |                
search RasMol script viewer Motif-ligand binding stats  nest .. | | | |    | |        | |                ||  | |                                         | || |   |  |                  |   ***  ***  |  |     | |                
search RasMol script viewer Motif-ligand binding stats  niche .. *** ***    ***        | |                |******                                         ******   ****                  |          *******     | |                
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       | |                *****                                                                          |                      | |                
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                                                               |                      ***                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                  ***                              *   **  *     *     ** **** **                  
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                      |||      * * *                   |   ||  |     |     || |||| ||                  
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** * *|||      | | |   *  *            |   ||  |     |     || |||| ||                  
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || | ||||      | | |   |  |            |   *|  *     *     || |||| ||                  
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || | |||*      | | | * |  |            |   ||  |     |     || |||| ||                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            | | | |    | ||   |  |   || ||||  |                       ||||| |            |    | |  || |   ^***^*** || |||||| |||  |||  |  |  | || ||  | |||| |||   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | | ^**    | ||   |  |   || ||||  |                       ||||| |            |    | |  || |    | |  |  || |||||| |||  |||  |  |  | || ||  | |||| |||   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | |        | ||   ^***   || ||||  |                       ||||| |            |    | ^***| |    | |  |  || |||||| |||  |||  |  |  | || ||  ^***|| |||   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | |        | ||   |  |   || ||||  |                       ||||| |            ^*****     | |    | |  |  || |||||| |^*****|  |  |  | || ||    | || |||   
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..            | |        | ||   |  |   || ||||  |                       ||||| |                       | |    | |  |  |***^^**^**||  | |  |  |  | || ||    | || |||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |        | ||   |  |   ******|  |                       ||||| |                       | |    | |  |  |  *********|  | |  |  |  | || ||    | |*****   
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |        | ||   ****   ***** ****                       ||||| |                       | |    | |  ****  *********|  | |  |  |  | |****    *******    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            ***        | ||                |  |                       *******                       ***    ***           |   | |  | |  |  |  | || |                
search RasMol script viewer Motif-ligand binding stats  nest ..                       | ||                |  |                                                                          |   ***  | |  |  |  ******                
search RasMol script viewer Motif-ligand binding stats  niche ..                       ****                ****                                                                          |        *********                        
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                                                               |                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                  ***                              *   **  *     *     **   *** *                  
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                      |||      * * *                   |   ||  |     |     ||   ||| |                  
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                ** * *|||      | | |   *  *            |   ||  |     |     ||   ||| |                  
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                || | ||||      | | |   |  |            |   *|  *     *     ||   ||| |                  
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    || | |||*      | | | * |  |            |   ||  |     |     ||   ||| |                  
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..            | | | |           |  |   || |||| || |      | |         | |||||               |    | |  |  |   ^***^***  |  ||| ||||    ||  |  |           | || |  |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..            | | ^**           |  |   || |||| || |      | |         | |||||               |    | |  |  |             |  ||| ||||    ||  |  |           | || |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | |               ^***   || |||| || |      | |         | |||||               |    | ^***  |             |  ||| ||||    ||  |  |           ^*** |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | |               |  |   || |||| || |      | |         | |||||               ^*****    |  |             |  ||| |||^*****|  |  |             |  |  |    
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..            | |               |  |   || |||| || |      | |         | |||||                         |  |             ***^^**^**      |  |  |             |  |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | |               |  |   *****|| || |      | |         | |||||                         |  |                 *****       |  |  |             |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | |               ****   *********| |      | |         | |||||                         |  |                 ****        |  |  |             *******    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..            | |                            |  ***      | |         *******                         |  |                  |          |  |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..            | |                            |  |        ***                                         |  |                  |          |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..            ***                            ****                                                    ****                  |          *******                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MATRIX METALLOPROTEINASE-2
member of: CATH:search3.40.390.10GENE3D:searchG3DSA_2.10.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00040/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00023, PROSITE PROFILES:searchPS51092, SMART:searchSM00059/searchSM00235SUPERFAMILY:searchSSF55486/searchSSF57440UniProt:searchP08253
JMol viewer RasMol script viewer  I52 800A  ..                                                                                 ****                              *   **  *     *    *** ***  **  *               
JMol viewer RasMol script viewer  CA 168A  ..                                                           *                     ||||      * * *                   |   ||  |     |    ||| |||  ||  |               
JMol viewer RasMol script viewer  CA 167A  ..                                                           |                **** *|||      | | |   *  *            |   ||  |     |    ||| |||  ||  |               
JMol viewer RasMol script viewer  ZN 166A  ..                                                           |                |||| ||||      | | |   |  |            |   *|  *     *    ||| |||  ||  |               
JMol viewer RasMol script viewer  ZN 165A  ..                                                           |         * *    |||| |||*      | | | * |  |            |   ||  |     |    ||| |||  ||  |               
sec str:  .................eeeee.......hhhhhhhhhhhhhhhhhh.....eee.......eeeee..................eee..........eee.............hhhhhhhhhhhhh.........................hhhhhhhhhhhh.
sequence :  ..MYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTNTSANYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYG
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |  | | | |           |  || |||||||| ||           | |    | | |||||               |    | |  || |   ^***^***  | |||||| |||   ||  |  |           || |||  |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |  | | ^**           |  || |||||||| ||           | |    | | |||||               |    | |  || |             | |||||| |||   ||  |  |           || |||  |  | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |  | |               ^***| |||||||| ||           | |    | | |||||               |    | ^***| |             | |||||| |||   ||  |  |           ^***||  |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |  | |               |  || |||||||| ||           | |    | | |||||               ^*****     | |             | |||||| |^*****|  |  |           || |||  |  | 
search RasMol script viewer Motif-ligand binding stats  ZINC_PROTEASE ..       | |  | |               |  || |||||||| ||           | |    | | |||||                          | |             ***^^**^**||    |  |  |           || |||  |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |  | |               ***** |******| ||           | |    | | |||||                          | |               ****** |||    |  |  |           ******  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |  | |               ****************|           | |    | | |||||                          | |               *********|    |  ****           ************ 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***  ***                            |  |           | |    *********                          ***                  |   | |    |  |  |                        
search RasMol script viewer Motif-ligand binding stats  nest ..                                           |  |           | |        ***                                                 |   ***    |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche ..                                           ****           ***                                                            |          *******                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                         *                                         

   New search    1hov:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML