triangle PDBeMotif: 1hny  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.2.1.1
Classification hydrolase (o-glycosyl)    | release date: Wed, Jun 28, 1995
Title the structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes
Authors G.D.BRAYER, Y.LUO
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA   search CL CL binding statistics CL
Modified residues:  search PCA PCA binding statistics PCA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFR
NMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDC
RLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGE
PIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARL
YKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNV
VDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSIS
NSAEDPFIAIHAESKL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HUMAN PANCREATIC ALPHA-AMYLASE
member of: CATH:search2.60.40.1180/search3.20.20.80GENE3D:searchG3DSA_2.60.40.1180/searchG3DSA_3.20.20.80PANTHER:searchPTHR10357/searchPTHR10357_SF105PFAM:searchPF00128/searchPF02806PRINTS:searchALPHAAMYLASESMART:searchSM00632/searchSM00642SUPERFAMILY:searchSSF51011/searchSSF51445UniProt:searchP04746
JMol viewer RasMol script viewer  CL 498A  ..                                                                                                                                                                                                  *                                                          *                                           *                                      *                                                                                                                                                               
JMol viewer RasMol script viewer  CA 497A  ..                                                                                                   *                                                         *        *                           |     *                                                    |                                           |                                      |                                                                                                                                                               
sec str:  .............eeeee....hhhhhhhhhh........eeee...............hhhhh.............hhhhhhhhhhhhhh..eeeeee...................................hhh..................hhhhhh..hhh........hhhhhhhhhhhhhhhhh...eeee..hhh..hhhhhhhhhh...............eeee...........hhhh........hhhhhhhhhhhh......hhhhhh..hhh....hhh.........hhh.....hhh...hhhhhhhhhhhhhhhh.....eeeee............................................hhh.hhhhhhhhhhhhh..............eeeeee...eeeeee.....eeeeee.....eeee...............eeee....eeeeee.......eeeee.....
sequence :  ..EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461       471       481       491   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      |  |     |  |               | |      | |       | |         | |    | ||  |       | |||         |  |  | ||  | |||  | || |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |     |     |||   || |||  |   ||  ||| ||| || ||      ||  | ||  | || |  |          |  | |       | |       |   || |    |  |      | |||     ||||||          | |||| | ||  ^***     |  |     | |         |||   |  | |      |^***|      | |     | ||||     || |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |     |  |               | |      | |       | |         ^**    | ||  |       | |||         |  |  | ||  | |||  | || |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |     |     |||   || |||  |   ||  ||| ||| |^**|      ||  | ||  | || |  |          |  | |       ^**       |   || |    |  |      | |||     ||||||          | |||| | ||  | |      |  |     | |         |||   |  | |      |    |      | |     | ||||     || |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      |  |     |  |               | |      | |       | |         | |    ^***  |       | |||         |  |  | ||  | |||  | || |      ^***||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |     |     |||   || |||  |   ||  ||| ||| || ||      ||  | ||  | || ^***          |  | |                 |   || |    |  |      | |||     ||||||          | |||| | ||  | |      |  |     | |         |||   ^*** |      |    |      | |     | ^***     || |||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      |  |     |  |               | |      | |       | |         | |      |   |       | |||         |  |  | ||  | |||  | || |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |     ******^||   || |********^|  ||| ||| || ||      ||  | ||  | || |  |          |  | |                 |   || |    |  |      | |||     ||||||          | |||| | ||  | |      |  |     | |         |||   |  | |      |    |      | |     | |||      || |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      |  |     |  |               | |      | |       | |         | |      |   |       | |||         |  ^*****^*****||  | || |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |            ^*****| |||  |    |  ||| ||| || ||      ||  | |^*****| |  |          |  | |                 ^***** |    |  |      | |||     ||||||          | ||^*****|  | |      |  |     | |         |^*****  | |      ^*****      | |     | |||      || |||
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..      |  |     |  |               | |      | |       | |         | |      |   |       | |||         |  |  |     | |||  | || |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |             |   || |||  |    |  ||| ||| || ||      ||  | |   |  | |  |          |  | |                     |  |    |  |      | |||     ||||||          | || | |  |  | |      |  |     | |         | |      | |                  | |     | |||      || ***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |  |     |  |               | |      | |       | |         | |      |   |       | |||         |  |  |     | |||  | || |      || ||***** | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |             |   || |||  |    |  ||| ||| *****      ||  | |   |  | |  |          |  | |                     |  |    |  |      | |||     ||||||          | || | |  |  | |      |  |     | |         | |      | |                  | |     | |||      || || 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |  |     |  |               | |      | |       | |         | |      *****       | |||         |  |  |     | |||  | || |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   ||| ||  |      |      | ||  |             |   || |||  |    |  ||| ||| || ||      ||  | |   |  | |  |          |  | |                     |  |    |  |      | |||     ||||||          | || | |  |  | |      |  |     | |         | |      | |                  | |     | |||      || || 
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |  |     |  |               | |      | |       | |         | |                  | |||         |  |  |     | |||  ***| |      || |||| || | | |  |  |   |  | |  |   |  ||   |           | |   | |||| |        |  |   *** ||  |      |      | ||  |             |   || |||  |    |  ||| ||| || ||      ||  | |   |  | |  |          |  | |                     |  |    |  |      | |||     ||||||          | || | |  |  ***      |  |     | |         | |      ***                  | |     | |||      || || 
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****     |  |               | |      | |       | |         | |                  ****|         |  |  |     ****|     | |      ****|****| | | |  ****   |  | ****   |  ||   |           | |   | ||****        |  |    |  ||  |      |      | |****             |   |********    |  |*****| ****|      ||  | |   |  | ****          |  | |                     |  |    ****      ****|     |*****          | **** |  |  | |      ****     | |         | |                           | |     ****|      ****| 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |     |  |               | |      | |       ***         | |                    | |         |  |  |       | |     | |       |  | |  | | | |  |  |   |  |        |  ||   |           | |   | |||| |        |  |    |  ||  |      |      | |                 |   |  | |       |  |   | |  |  |      ||  | |   |  |               |  | |                     |  |                | |     |||| |          | || | |  |  | |               | |         | |                           | |     | |||       |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |     |  |               ***      | |                   | |                    ***         |  |  |       ***     ***       |  | |  | | ***  |  |   |  |        |  ||   |           ***   | |*** |        |  |    |  ||  |      |      | |                 |   |  ***       |  |   ***  |  |      ||  ***   |  |               |  | |                     |  |                ***     **** |          | || | |  |  ***               | |         ***                           ***     | |||       |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..      ****     ****                        ***                   ***                                |  ****                         **** ****** | |  ****   ****        ****|   |                 | | ****        ****    ********      |      ***                 |   |    |       ****        ****      ||        ****               ******                     ****                          ****          ****** ****                    ***         | |                                   ****|       **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                                    |                                           | |                         |   |                 | |                                   |                          |   ******                             ||                                                                                                                                             | |                                   | | |            
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                                    |                                           | |                         |   |                 | |                                   |                          |   |                                  ||                                                                                                                                             | |                                   *****            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                    |                                           | |                         *****                 | |                                   |                          *****                                  ||                                                                                                                                             | |                                   | |              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                    |                                           ***                                               | |                                   |                                                                 ||                                                                                                                                             ***                                   ***              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                    *                                                                                             * *                                   *                                                                 **                                                                                                                                                                                                    

   New search    1hny:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML