triangle PDBeMotif: 1hkc  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.1
Classification phosphotransferase    | release date: Wed, Jul 1, 1998
Title recombinant human hexokinase type i complexed with glucose and phosphate
Authors A.E.ALESHIN, R.B.HONZATKO
Method X-RAY DIFFRACTION (resolution: 2.80Å)
PDBe Citation   
Small molecules:    search BGC BGC binding statistics BGC   search PO4 PO4 binding statistics PO4   search K K binding statistics K
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDF
IALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQ
SKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLF
EGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
KGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLT
KDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIY
AIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDA
IKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDD
IRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQV
RAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVK
ELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTEASS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : D-GLUCOSE 6-PHOSPHOTRANSFERASE
member of: CATH:search3.30.420.40/search3.40.367.20GENE3D:searchG3DSA_3.30.420.40/searchG3DSA_3.40.367.20PANTHER:searchPTHR19443/searchPTHR19443_SF10PFAM:searchPF00349/searchPF03727PRINTS:searchHEXOKINASEPROSITE PATTERNS:searchPS00378, PROSITE PROFILES:searchPS51748, SUPERFAMILY:searchSSF53067UniProt:searchP19367
JMol viewer RasMol script viewer  K 922A  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  *  *  * **                                                                                                                                                                                                                       
JMol viewer RasMol script viewer  K 921A  ..                                                                                                                                                                                                                                  *  *  * *                                                                                                                                                                                                                                                                                                                                                                                                                                                       |  |  | ||                                                                                                                                                                                                                       
JMol viewer RasMol script viewer  PO4 920A  ..                                                                                                                                                                                                                                  |  |  | |                                                                                                                                                                                                                                                                                                                                                                                                                                            **         |  |  | ||                                                                                                                                                                  **                                                   
JMol viewer RasMol script viewer  PO4 919A  ..                                                                        *                                                                                                                                               *         |  |  | |                                                                                                                                                                   **                                                                                                                                                                                                                                                                       ||         |  |  | ||                                                                                                                                                                  ||                                                   
JMol viewer RasMol script viewer  BGC 918A  ..                                                                        |                                                                  ***              **                                  **                   *  |* *      |  |  | |         *                              *  *                                                                                                                       ||                                                                                                                                                                                                                                                                       ||         |  |  | ||                                                                                                                                                                  ||                                                   
sec str:  ...hhhhhhhhh.hhh...hhhhhhhhhhhhhhhhhhh....hhh...................eeeeeeee....eeeeeeee........eeeeeee..........hhhhhhhhhhhhhhhhh.........eeeeee..............................hhhhhhhhhhhh.....eeeeee.hhhhhhhhhh.....eeeeeee...eeeeeeeehhh.........eeeee..hhh............hhhhhhhh..........hhh..hhhhhhhhhhhhhhhhh....hhh.............hhhhhhh.....hhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eeeeeeee.hhhhh...hhhhhhhhhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh....hhh...................eeeeeeee...eeeeeeeeee.....eeeeeeeeee..hhhh......hhhhhhhhhhhhhhh.......eeeeeee..eeee.....eeeee..............hhhhhhhhhhhh....eeeeeee.hhhhhhhhhh.....eeeeeee...eeeeeeeehhh.........eeeee..hhh............hhhhhhhh..................hhhhhhhhhhhhhh....hhh.............hhhhhhh......hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.hhhhh...hhhhhhhhhhhh...eeeeeee......hhhhhhhhhhhhhh..
sequence :  ..DDQVKKIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNGCLDDIRTHYDRLVNEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGAALITAVGVRLRTE
seq num:  ..16        26        36        46        56        66        76        86        96        106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316       326       336       346       356       366       376       386       396       406       416       426       436       446       456       466       476       486       496       506       516       526       536       546       556       566       576       586       596       606       616       626       636       646       656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896       906      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    |     || || |  || |          |  |   |  |||| | | | |  ||||| |         | |                       |  |                   || |||| | | |    |     || ||      ||||  |||| || |         ||||        ^***|    ||  | ||  | |  |||   |  |  ||  |          ||||||||||||||||| ||   |  | |  || || ||||    |         | ||||     ||| || |||^*** || ||   |    |  |  |||  |||||   |   |  | |         |    |    | | |     |   ||| ||   | |   | |              ||| | |       |  ||   |  || |  |                  |  | |||  |  | | | |    ||||  |                   ||||||          |  || |||||            || ||||     |    |     || |||    |   |   ||| |            ||||        ^***||   |   |  |  | |  |||   |  |  ||| | | |      ||||||||||||| |||  ||  |  | |  || | || || |  ||    |   | ||||  |  ||| || | |  |  || || |||  ||   |  |||^***|||||| |     | |     | |  ||     | |||   ^***|    ||  |         | || | ||^***    ||| | |   |         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    |     || || |  || |          |  |   |  |||| | | | |  ||||| |         | |                       |  |                   || |||| | | |    |     || ||      ||||  |||| || |         ||||         |  |    ||  | ||  | |  |||   |  |  ||  |          ||||||||||||||||| ||   |  | |  || || ||||    |         | ||||     ||| || ||||| | || ||   |    |  |  |||  |||||   |   |  | |         |    |    | | |     |   ||| ||   | |   | |              ||| | |       |  ||   |  || |  |                  |  **^*|  |  | | | |    ||||  |                   ||**^*          |  || |||||            || ||||     |    |     || |||    |   |   ||| |            ||||        ||  ||   |   |  |  | |  |||   |  |  ||| | | |      ||||||||||||| |||  ||  |  | |  || | || || |  ||    |   | ||||  |  ||| || | |  |  || || |||  ||   |  ||| ||||||||| |     | |     | |  ||     | |||       |    ||  |         | || | ||        ||| | |   |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    |     || || |  || |          |  |   |  |^** | | | |  ||^** |         ^**                       |  |                   || |||| | | |    |     || ||      ^**|  |||| || |         ||||         |  |    ||  | ||  | |  |||   |  |  ||  |          ||||||||||||||||| ||   |  | |  || || ||||    |         | ||||     ||| || ||||| | || ||   |    |  |  |||  |||||   |   |  ^**         |    |    | ^**     |   ||| ||   ^**   ^**              ||^** |       |  ||   |  || |  |                  |  |   |  |  | | | |    ||||  |                   ^**|            |  || |||||            || ||||     |    |     || |||    |   |   ||| |            ||||        ||  ||   |   |  |  | |  |||   |  |  ||| | | |      ||||||||||||| |||  ||  |  | |  || | || || |  ||    |   ^**|||  |  ||^**| | |  |  || |^**||  ||   |  ||| ||||||||| |     ^**     | |  ||     | |||       |    ||  |         ^**| ^**|        ||^** |   |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    |     || || |  ^***          |  |   |  | || | | | ^***| |  |                                   |  |                   || |||| | | |    |     ^***|       | |  ^*** || |         ||||         |  |    ||  | ||  | |  |||   |  |  ||  |          ||||||||||^***||^***   |  | |  || || ||||    |         | ||||     ||| || ||||| | ^***|   |    |  |  |||  ^***|   |   |              |    |    | |       |   ||| ||     |   |                |||   |       |  ||   |  || |  |                  |  |   |  |  | | | |    ||||  |                   || |            |  || |^***            || ||||     |    |     ^***||    |   |   ||| |            ||||        ||  ||   |   |  |  | |  |||   |  |  ||| | | |      ||||||||||||| ||^***|  |  | |  || | || || |  ||    |   | ||||  |  |||  | | |  |  ^***| |||  ||   |  ||| ^***||||| |             | |  ||     | |||       |    ||  |         ^*** |  |        |||   |   |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..    *******^ || |   |            |  |   |  | || | | |     | |  |                                   |  |                   || |||| | | |    |      |  |       | |   ||| || |         ||||         |  |    ||  | ||  | |  |||   |  |  ||  |          ||||||||||||| ||| |    |  | |  || || ||||    |         | ||||     ||| || ||||| | ||  |   |    |  |  |||  ||| |   |   |              |    |    | |       |   ||| ||     |   |                |||   |       |  ||   |  || |  |                  |  |   |  |  | | | |    ||||  |                   || |            |  || |||||            || ||||     |    |      |  ||    |   |   ||| |            ||||        ||  ||   |   |  |  | |  |||   |  |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || || |  ||    |   | ||||  |  |||  | | |  |   |  | |||  ||   |  ||| ||| ||||| |             | |  ||     | |||       |    ||  |              |  |        |||   |   |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          || || |   |            |  |   |  | || | | |     ^*****                                   |  |                   || |||| | | |    |      |  |       | |   ^***** |         ||||         |  ^*****|  | ||  ^*****^*****  |  ||  |          ||||||||||||| ||| |    |  | |  || || |||^*****         | ||||     ||| || ||||| | ||  |   ^*****  |  |^*****| |   |   |              ^*****    | |       ^*****| ||     |   |                |^*****       |  ||   |  || |  |                  |  |   |  |  | | | |    |^*****                   || |            |  || |||||            || ||||     |    |      |  |^*****   |   ||| |            ||||        ||  ^*****   |  |  ^*****^*****  |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || |^*****|    |   | ||||  |  |||  | ^*****   |  | |||  ||   |  |^***** ||||| |             ^*****|     | |||       ^*****|  |              |  |        |^*****   |         
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..          || || |   |            |  |   |  | || | | |     | |                                      |  |                   || |||| | | |    |      |  |       | |   ||| || |         ||||         |        |  | ||    |    |      |  ||  |          ||||||||||||| ||| |    |  | |  || || |||               | ||||     ||| || ||||| | ||  |           |  | |  | | |   |   |                        | |           | | ||     |   |                | |           |  ||   |  || |  |                  |  |   |  |  | | | |    ||||                      ^***            |  || |||||            || ||||     |    |      |  |         |   ||| |            ||||        ||  ||       |  |    |    |      |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || |  |  ||    |   | ||||  |  |||  | | |      |  | |||  ||   |  | | ||  ||||| |               |  ||     | |||             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  RGD ..          || || |   |            |  |   |  | || | | |     | |                                      |  |                   || |||| | | |    |      |  |       | |   ||| || |         ***|         |        |  | ||    |    |      |  ||  |          ||||||||||||| ||| |    |  | |  || || |||               | ||||     ||| || ||||| | ||  |           |  | |  | | |   |   |                        | |           | | ||     |   |                | |           |  ||   |  || |  |                  |  |   |  |  | | | |    ||||                       | |            |  || |||||            || ||||     |    |      |  |         |   ||| |            ||||        ||  ||       |  |    |    |      |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || |  |  ||    |   | ||||  |  |||  | | |      |  | |||  ||   |  | | ||  ||||| |               |  ||     | |||             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  HEXOKINASE_1 ..          || || |   |            |  |   |  | || | | |     | |                                      |  |                   || |||| | | **************************   ||| || |         ||||         |        |  | ||    |    |      |  ||  |          ||||||||||||| ||| |    |  | |  || || |||               | ||||     ||| || ||||| | ||  |           |  | |  | | |   |   |                        | |           | | ||     |   |                | |           |  ||   |  || |  |                  |  |   |  |  | | | |    ||||                       | |            |  || |||||            || ||||     **************************   ||| |            ||||        ||  ||       |  |    |    |      |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || |  |  ||    |   | ||||  |  |||  | | |      |  | |||  ||   |  | | ||  ||||| |               |  ||     | |||             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          || || |   |            |  |   |  | || | | |     | |                                      |  |                   || |||| | |      |      |  |       | |   ||| || |         ||||         |        |  | ||    |    |      *****  |          |||||||||||*****| |    |  | |  || |*****               | ||||     ||| || ||||| | ||  |           |  | |  | | |   |   |                        | |           | | ||     |   |                | |           *****   ***** |  |                  |  |   |  |  | | | |    ||||                       | |            ***** |||||            || ||||          |      |  |             ||| |            ||||        ||  ||       |  |    |    |      *****| | | |      ||||||||||||| |||   |  |  | |  || | || |  *****    |   | ||||  |  |||  | | |      |  | ||*****   |  | | ||  ***** |               *****     | |||             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          || || |   |            |  |   |  | || | | |     | |                                      |  |                   || |||| | |      |      |  |       | |   ||| || |         ||||         |        |  | ||    |    |      |  ||  |          ||||||||||||| ||| |    |  | |  || || ||                | ||||     ||| || ||||| | ||  |           |  | |  | | |   |   |                        | |           | | ||     |   |                | |           |  |    |  |  |  |                  |  |   |  |  | | | |    ||||                       | |            |  |  |||||            || ||||          |      |  |             ||| |            ||||        *****|       |  |    |    |      |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || |  |  |     |   | ||||  |  |||  | | |      |  | |||  |    |  | | ||  ||||  |               |  |      | |||             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..          || || |   |            |  |   |  | || | | |     | |                                      |  |                   || |||| | |      |      |  |       | |   ||| |***         ||||         |        |  ***|    |    |      |  ||  |          ||||||||||||| ||| |    |  | |  || || ||                | ||||     ||| || ||||| | ||  |           |  | |  | | |   |   |                        | |           | | ||     |   |                | |           |  |    |  |  |  |                  |  |   |  |  | | | |    ***|                       | |            |  |  |||||            || ||||          |      |  |             ||| |            ||||         |   |       |  |    |    |      |  ||| | | |      ||||||||||||| |||   |  |  | |  || | || |  |  |     |   | ||||  |  |||  | | |      |  | |||  |    |  | | ||  ||||  |               |  |      | |||             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ****| |   |            |  |   |  | || | | |     | |                                      ****                   |****|| | |      |      |  |       | |   |****            ||||         |        |  |  |    |    |      ****|  |          ||********|****|| |    **** ****| *****                ****||     ||*******|**** ||  |           **** |  | | |   |   |                        | |           | | ||     |   |                | |           ****    ****  ****                  |  |   ****  | | | |    ||||                       | |            *******||||            |****||          |      |  |             ||| |            ||||         |   |       |  |    |    |      ****|| | | |      |*******|******||   |  **** ****| **** |  ****     |   | |||****  |||  | | |      **** ||****    **** | ||  ****  |               ****      ****|             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  | |   |            |  |   |  | || | | |     | |                                                             |  |||| ***      |      |  |       | |   ||| |            ||||         |        |  |  |    |    |          |  |          |||| || |||||  || |    |  | |  || |                      ||||     ||| || | | |   ||  |              | |  | | |   |   |                        | |           | | ||     |   |                ***                         |  |                  |  |   |  |  | | | |    ||||                       | |                   ||||            |  ||||          |      |  |             ||| |            ||||         |   |       |  |    |    |         *** | | |      |||| || |||||  ||   |  |  | |  || | |  |           |   | ||||     |||  | | |      |  | ||           | ***|   ||   |                           | |             |  |              |  |        | |   |   |         
search RasMol script viewer Motif-ligand binding stats  nest ..           |  | |   |            |  |   |  | |*** ***     | |                                                             |  ****          |      |  |       | |   *** |            ****         |        |  |  |    |    |          |  |          **** |******|  || |    |  | |  |***                      ****     ||| || *** |   ||  |              ***  | | |   |   |                        ***           | | ||     |   |                                            |  |                  |  |   |  |  *** ***    ****                       | |                   ****            |  ****          |      |  |             *** |            ****         |   |       |  |    |    |          |  | | |      **** |******|  ||   |  |  | |  |*** |  |           |   | ****     |||  | ***      |  | ||           ***  |   ||   |                           ***             |  |              |  |        ***   |   |         
search RasMol script viewer Motif-ligand binding stats  niche ..           **** |   |            ****   ******            ***                                                             |    |           |      ****       ***   *****                         |        *******    |    |          ****            ****      ****| |    **** ****                                  ||****     |   |****                   | | |   |   |                                      | ****     |   |                                            ****                  ****   ****      | |     ***                       ***                   | |             |   ***          |      ****             *****                         |   |       ****    |    |          **** ***        ****      ****|   |  **** ****    ****           |   |          ||****          *******                |   ||   |                                           ****              ****              |   |         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                |   |                                                                                                     ******           |                                                     |                   |    |                                        | |                                               ||  ||     |   |                       | | |   |   |                                      |   |      |   |                                                                                   | |                                                     | |             ******           |                                                     |   |               |    |                                        |   |                              |   |          |||  |             | |                 |   ||   |                                                                               |   |         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                *****                                                                                                                      |                                                     |                   |    |                                        | |                                               *****|     |   |                       *****   |   |                                      |   |      |   |                                                                                   | |                                                     | |                              |                                                     |   |               |    |                                        *****                              |   |          |||  |             | |                 *****|   |                                                                               |   |         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                                                                           |                                                     |                   ******                                        | |                                                *****     *****                       | |     *****                                      *****      *****                                                                                   | |                                                     | |                              |                                                     *****               ******                                                                           *****          |*****             | |                 **********                                                                               *****         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                           |                                                     |                                                                 ***                                                                                      ***                                                                                                                                                   ***                                                     ***                              |                                                     |                                                                                                                   ***                ***                                                                                                                        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                           *                                                     *                                                                                                                                                                                                                                                                                                                                                                                                         *                                                     *                                                                                                                                                                                                                                                                 

   New search    1hkc:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors