triangle PDBeMotif: 1hgv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification virus    | release date: Fri, Dec 15, 2000
Title filamentous bacteriophage ph75
Authors D.A.MARVIN, D.M.PEDERSON, L.C.WELSH, M.R.SLATER, M.SAMPSON, M.YU, R.N.PERHAM
Method FIBER DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PH75 INOVIRUS MAJOR COAT PROTEIN
member of: CATH:search1.20.5.80GENE3D:searchG3DSA_1.20.5.80SUPERFAMILY:searchSSF57987UniProt:searchP82889
sec str:  ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
seq num:  ..1         11        21        31        41    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | ||||| |    |  || |     ^*****         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *****|| |    ***** |      |  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..      **** ****    *******      ****          
search RasMol script viewer Motif-ligand binding stats  ststaple ..        *****                                 

   New search    1hgv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors