triangle PDBeMotif: 1hfp  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.5.1.3
Classification oxidoreductase    | release date: Tue, Nov 4, 1997
Title comparison of ternary crystal complexes of human dihydrofola reductase with nadph and a classical antitumor furopyrimdin
Authors A.GANGJEE, J.R.LUFT, N.GALITSKY, R.L.BLAKLEY, V.CODY, W.PANGBORN
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search NDP NDP binding statistics NDP   search MOT MOT binding statistics MOT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEGRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELK
EPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLP
EYPGVLSDVQEEKGIKYKFEVYEKND
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : DIHYDROFOLATE REDUCTASE
member of: CATH:search3.40.430.10GENE3D:searchG3DSA_3.40.430.10PANTHER:searchPTHR11549/searchPTHR11549_SF11PFAM:searchPF00186PRINTS:searchDHFRPROSITE PATTERNS:searchPS00075, PROSITE PROFILES:searchPS51330, SUPERFAMILY:searchSSF53597UniProt:searchP00374
JMol viewer RasMol script viewer  MOT 188A  ..      ***            *       **  **                       **   *  *  *                                            *                    *                                                  
JMol viewer RasMol script viewer  NDP 187A  ..      |**      **  ***       ||  ||                 ****  *|   |  |  |    ****            **                      * ***** *            |                                                  
sec str:  .....eeeeeee.................hhhhhhhhhhhh.........eeeeehhhhhh..hhh......eeeee............eee..hhhhhhhhh.hhhh.....eee...hhhhhhh.....eeeeeeeee...............................eee..eeeeeeeeeee.
sequence :  ..VGSLNCIVAVSQNMGIGKNGDLPWPPLRNEGRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |    |     | |  | |||       |   | ||| |^*** |     |  ||| ^*** || |  |     | ||   |  |     ^***|  |  |  || ||              |  |                        |||||     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ^*****     | ^*****||       |   | ||| |  |  |     |  ||| |||| || |  |     | ||   |  |     |   |  |  |  || ||              |  |                        |||||     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      |     | |  |  ||       |   | ||| |  |  |     ^***|| |||| || |  |     | ||   |  |     |   |  |  |  || ||              |  |                        |||||     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  DHFR_1 ..      |     | ************************ |  |  |         || |||| || |  |     | ||   |  |     |   |  |  |  || ||              |  |                        |||||     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      |     | |  |  ||       |   | ||| |  |  |         || |||| || |  |     | ||   |  |     |   |  |  |  || ||              |  |                        *****     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      |     | |  |  ||       |   | ||| |  |  |         || |||| || |  |     | ||   |  |     |   |  |  |  || ||              |  |                        *****     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..      |     | |  |  ||       |   | ||| |  |  |         || |||| || |  |     | ||   |  |     |   |  |  |  || ||              |  |                        ***||     |  || |   |  |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |     | |  ****|       |   | ||| |  ****         ****|****| |  |     | ||   |  |     |   |  |  |  ****|              |  |                        ****|     ****| |   ****           
search RasMol script viewer Motif-ligand binding stats  nest ..      |     ***      |       |   | ||| |  |  |          |  | |  | |  |     | ||   |  |     |   |  |  |   |  |              |  |                         |  |     |  || |                  
search RasMol script viewer Motif-ligand binding stats  niche ..      |              |       |   | |****  ****          **** **** ****     ****   ****     |   |  ****   ****              ****                         ****     *******                  
search RasMol script viewer Motif-ligand binding stats  stmotif ..      |              |       |   | | | |                          |        | |             *****                                                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..      |              |       |   *******                          |        | |                                                                                                            
search RasMol script viewer Motif-ligand binding stats  stturn ..      |              |       |   |                                |        ***                                                                                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..      *              *       *   *                                *                                                                                                                       

   New search    1hfp:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML