triangle PDBeMotif: 1hf0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription    | release date: Mon, Nov 27, 2000
Title crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Authors A.REMENYI, A.TOMILIN, E.POHL, H.R.SCHOLER, M.WILMANNS
Method X-RAY DIFFRACTION (resolution: 2.70Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAENLSSD
SSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRIN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OCTAMER-BINDING TRANSCRIPTION FACTOR 1
member of: CATH:search1.10.10.60/search1.10.260.40GENE3D:searchG3DSA_1.10.10.60/searchG3DSA_1.10.260.40PANTHER:searchPTHR11636/searchPTHR11636_SF47PFAM:searchPF00046/searchPF00157PRINTS:searchOCTAMER/searchPOUDOMAINPROSITE PATTERNS:searchPS00027/searchPS00035/searchPS00465, PROSITE PROFILES:searchPS50071/searchPS51179, SMART:searchSM00352/searchSM00389SUPERFAMILY:searchSSF46689/searchSSF47413UniProt:searchP14859
sec str:  ..hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhh....hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..
sequence :  ..LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAE..RKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
seq num:  ..6         16        26        36        46        56        66        ..102       112       122       132       142       152     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |   |  || | | | ||||  |||    |  |   || ||||||||^***|^***||           .. | ||  |   |  || || ||   | || |||   | |         | |  | || 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |   |  || | | | ||||  |||    |  |   || ||||||||||||| || ||           .. **^*  |   |  || || ||   | || |||   | |         | |  | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |   |  |^** | | ||||  |||    |  |   || ||||||||||^** || ||           ..    |  |   |  || || ||   | || |||   | |         ^**  | || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**   |  ||   | | |||^***||    |  |   || ||^***||||||  || ||           ..    ^***   |  || ^***|   ^*** |||   | |              | || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  ||   | | ||||   |^*****  ^***** || || ||||||  || ||           ..           |  ||  |  |     |  |||   | |              | || 
search RasMol script viewer Motif-ligand binding stats  HOMEOBOX_1 ..     |  ||   | | ||||   ||           |  || || ||||||  || ||           ..           |  ||  |  |     |  ||************************| 
search RasMol script viewer Motif-ligand binding stats  POU_1 ..     |  ||   *************           |  || || ||||||  || ||           ..           |  ||  |  |     |  ||    | |              |  | 
search RasMol script viewer Motif-ligand binding stats  POU_2 ..     |  ||     | ||||   |            **************|  || ||           ..           |  ||  |  |     |  ||    | |              |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     *****     | ||||   |            ***** || ||||||  *****           ..           *****  |  |     *****    | |              |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****      ****||   |            ****  |****||||  ****            ..           ****   |  |     ****     | |              **** 
search RasMol script viewer Motif-ligand binding stats  nest ..                 ***|   |                  |  ****||  ||              ..                  |  |              ***              |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..                    |   |                  |   ***||  ||              ..                  ****                               **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                    |   |                  ****** ||  ||              ..                                                          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                    *****                         *****|              ..                                                          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                   *****              ..                                                          

chain B : OCTAMER-BINDING TRANSCRIPTION FACTOR 1
member of: CATH:search1.10.10.60/search1.10.260.40GENE3D:searchG3DSA_1.10.10.60/searchG3DSA_1.10.260.40PANTHER:searchPTHR11636/searchPTHR11636_SF47PFAM:searchPF00046/searchPF00157PRINTS:searchOCTAMER/searchPOUDOMAINPROSITE PATTERNS:searchPS00027/searchPS00035/searchPS00465, PROSITE PROFILES:searchPS50071/searchPS51179, SMART:searchSM00352/searchSM00389SUPERFAMILY:searchSSF46689/searchSSF47413UniProt:searchP14859
sec str:  ..hhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhh.....hhhhhhhhhh...hhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhh...hhhhhhhhhhhhh.hhhhhhhhhhhhhhhhh..
sequence :  ..LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAE..RKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
seq num:  ..6         16        26        36        46        56        66        ..102       112       122       132       142       152     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | ||||||| | |   | ||  ||| |  | |||  || ||||||||^***|^***             .. | ||  |         || ||   |||| | |   | |  |  ||  ||| || || 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | ||||||| | |   | ||  ||| |  | |||  || |||||||||||||| ||             .. **^*  |         || ||   |||| | |   | |  |  ||  ||| || || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | ||||||^** |   | ||  ||| |  | |||  || ||||||||||^**| ||             ..    |  |         || ||   |||| | |   | |  |  ||  ^** || || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..** |||||||   |   | |^***|| |  | |||  || ||^***|||||| | ||             ..    ^***         ^***|   ^*** | |   | |  |  ||  ||  || || 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |||||||   |   | ||  ||^***** |^***** || || |||||| | ||             ..                  |  |   |||  | |   | |  |  ||  ||  || || 
search RasMol script viewer Motif-ligand binding stats  HOMEOBOX_1 ..   |||||||   |   | ||  ||| |  | | |  |  || || |||||| | ||             ..                  |  |   |||  | ************************| 
search RasMol script viewer Motif-ligand binding stats  POU_1 ..   |||||||   ************* |  | | |  |  || || |||||| | ||             ..                  |  |   |||  |     | |  |  ||  ||  || || 
search RasMol script viewer Motif-ligand binding stats  POU_2 ..   |||||||       | ||  ||  |  | | |  **************| | ||             ..                  |  |   |||  |     | |  |  ||  ||  || || 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ******|       | |*****  |  | | |  ***** || |||| | | ||             ..                  |  |   |||  |     | |  *********  || || 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ***** |       | |****|  **** | |  ****  |****|| | ****             ..                  |  |   |||  |     | |  ********   ****| 
search RasMol script viewer Motif-ligand binding stats  nest ..     |   |       ***|   |       ***        |  **** |   |              ..                  |  |   |||  |     ***              |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..     |   |          |   |                  |   *** |   |              ..                  ****   |||  |                      **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..     |   |          |   |                  ******  |   |              ..                         |||  |                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..     |   |          *****                          |   |              ..                         |||  |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..     *****                                         *****              ..                         |*****                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                      ..                         ***                              

chain M : DNA5'-D(*CP*AP*CP*AP*TP*TP*TP*GP*AP*AP*AP*GP*GP*CP*AP*AP*AP*TP*GP*GP*AP*G)-3';
sec str:  ........................
sequence :  ..CACATTTGAAAGGCAAATGGAG
seq num:  ..1         11          

chain N : DNA5'-D(*CP*TP*CP*CP*AP*TP*TP*TP*GP*CP*CP*TP*TP*TP*CP*AP*AP*AP*TP*GP*TP*G)-3';
sec str:  ........................
sequence :  ..CTCCATTTGCCTTTCAAATGTG
seq num:  ..1         11          

   New search    1hf0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML