triangle PDBeMotif: 1hc9  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification toxin/peptide    | release date: Wed, May 2, 2001
Title a-bungarotoxin complexed with high affinity peptide
Authors J.L.SUSSMAN, M.HAREL, R.KASHER
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search IOD IOD binding statistics IOD
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Chain B sequence:
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Chains C,D sequence:
WRYYESSLLPYPD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALPHA-BUNGAROTOXIN ISOFORM V31
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP60616
JMol viewer RasMol script viewer  IOD 1075A  ..                        * *                            ***                
sec str:  ...eeee......eeee......eeeeeee...hhhhhh.eeeeeee..........eeeee..............
sequence :  ..IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
seq num:  ..1         11        21        31        41        51        61        71  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | ||        |  |         | | ^**      ||   | ^**      || ^**|| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | ||        |  |         | |          ^*****          || ||||| |  |   
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..    | ||        |  |         | |          *^***^**********^^***||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | ||        |  |         ***                             | ||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | ||        ****                                         ****| ****   
search RasMol script viewer Motif-ligand binding stats  nest ..    | ||        |  |                                           *** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..    ****        ****                                               ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..    ***                                                                   

chain C : PEPTIDE INHIBITOR
sec str:  ...eee..eeeee..
sequence :  ..WRYYESSLLPYPD
seq num:  ..1         11 
search RasMol script viewer Motif-ligand binding stats  niche ..   ******    
search RasMol script viewer Motif-ligand binding stats  stturn ..      ***    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : ALPHA-BUNGAROTOXIN ISOFORM A31
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP60615
JMol viewer RasMol script viewer  IOD 1075B  ..                        * *                            * *                
sec str:  ...eeee......eeee......eeeeeee...hhhhhh.eeeeeee..........eeeee..............
sequence :  ..IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
seq num:  ..1         11        21        31        41        51        61        71  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | ||        |  |         | | ^**      ||   | ^**  |   || ^**|| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | ||        |  |         | |          ^*****   |  |   || ||||| |  |   
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..    | ||        |  |         | |          *^***^**********^^***||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | ||        |  |         ***                   |  |      | ||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | ||        ****                               |  |      ****| ****   
search RasMol script viewer Motif-ligand binding stats  nest ..    | ||        |  |                               |  |        *** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..    ****        ****                               ****            ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..    ***                                                                   

chain D : PEPTIDE INHIBITOR
sec str:  ....ee........
sequence :  ..WRYYESSLLPYP
seq num:  ..1           
search RasMol script viewer Motif-ligand binding stats  niche ..   ******   

   New search    1hc9:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors