triangle PDBeMotif: 1h4r  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification structural protein    | release date: Mon, May 14, 2001
Title crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.
Authors B.S.KANG, D.R.COOPER, P.SHEFFIELD, Y.DEVEDJIEV, Z.S.DEREWENDA
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search SO4 SO4 binding statistics SO4
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDK
KVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHK
RGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDAL
GLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MERLIN
member of: CATH:search1.20.80.10/search2.30.29.30/search3.10.20.90GENE3D:searchG3DSA_1.20.5.450/searchG3DSA_1.20.80.10/searchG3DSA_2.30.29.30/searchG3DSA_3.10.20.90PANTHER:searchPTHR23281/searchPTHR23281_SF17PFAM:searchPF00373/searchPF09379/searchPF09380PIRSF:searchPIRSF002305PRINTS:searchBAND41/searchERMFAMILYPROSITE PATTERNS:searchPS00660/searchPS00661, PROSITE PROFILES:searchPS50057, SMART:searchSM00295SUPERFAMILY:searchSSF47031/searchSSF50729/searchSSF54236UniProt:searchP35240
JMol viewer RasMol script viewer  SO4 1317A  ..                    *                                       *                                                                                                                                                                                                                                         
JMol viewer RasMol script viewer  SO4 1316A  ..                    |                                       |                                                   *                                       *                                                                                                                                             
JMol viewer RasMol script viewer  SO4 1315A  ..                    |                                       |                                                   |           *                           |                     **  *                                                                                                                   
JMol viewer RasMol script viewer  SO4 1314A  ..                    |                                       |                                                   |           |                           |                     ||  |                                      *    * *                                                                     
sec str:  ...eeeeeee....eeeeeee...hhhhhhhhhhhhhh..hhh.eeeeeee..eeee......hhhh.......eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh..................hhhhhh....hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......eeeeeee....eeeeee...eeeee.........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
seq num:  ..20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |  | |       |  |         || |||  || ||   |||||  | |  ||| || || ||             |    | |            |   |||||                     | |||| |||| |       |  |  |   |      |||||| | |      | | |  | || | |    |||||              |  | || ||   |  | ^***|||  | || | |||    ^***                  || |||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  | |       |  |         || |||  || ||   |||||  | |  ||| || || ||             |    | |            |   |||||                     | |||| |||| |       |  |  |   |      |||||| | |      | | |  | || | |    |**^*              |  | || ||   |  |   | |||  | || | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**  | |       |  |         || |||  || ||   ^**||  | |  ||| || || ||             |    | |            |   |||||                     | |||| |||| |       |  |  |   |      |||||| | |      | | |  | || | |    | | |              |  | |^**|   |  |   | ^**  ^**| | |||     ^**                  || |||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |       |  |         || |||  || ||   ^***|  | |  ||| || |^***             |    | |            |   |||||                     | |||| |||| |       |  |  |   |      |||||| | |      | | |  | || | |    | | |              |  | || ||   |  |   ^***      | | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | |       |  |         || |||  || ||    |  |  | |  ||| || || |              |    | |            ********^                     | |||| |||| |       |  |  |   |      |||||| | *******^ ********^ | |    | | |              |  | || ||   |  |             | | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |       |  |         || |^***** |^*****  |  | |  ||| || || |              |    | |                ||||                      | |||| |||| |       |  |  |   |      |||||| |            |  | || | |    | | |              |  | || ||   |  |             | | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  FERM_1 ..        | |       |  |         || |||  |  |     |  |  *******************************    | |                ||||                      | |||| |||| |       |  |  |   |      |||||| |            |  | || | |    | | |              |  | || ||   |  |             | | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  FERM_2 ..        | |       |  |         || |||  |  |     |  |    |  ||| || || |                   | |                ||||                      | |||| |||| |       |  |  |   |      |******************************    | | |              |  | || ||   |  |             | | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        | |       |  |         || |||  |  |     |  |    |  ||| || || |                   | |                ||||                      *****| |||| |       |  |  |   |      |||||| |            |  | || |      | | |              |  | || ||   |  |             | | |||     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  asxmotif ..        | |       |  |         || |||  |  |     |  |    |  ||| || || |                   | |                ||||                      *****| |||| |       |  |  |   |      |||||| |            |  | || |      | | |              |  | || ||   |  |             | *****     | |                  || |||
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |       |  |         || |||  |  |     |  |    |  ||| || || |                   | |                ||||                      ***| | |||| |       |  |  |   |      |||||| |            |  | || |      *** |              |  ***| ||   |  |             | ***|      | |                  || |||
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |       |  |         || |||  |  |     |  |    |  ||| || || |                   | |                ||||                      |  | | |||| |       |  |  |   |      |||||| |            |  | || |        | |              |  |  | **   |  |             | |  |      | |                  || |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |       ****         |****|  |  |     ****    |  |****| || |                   | |                ||||                      **** ****** |       |  |  |   |      ********            **** || |        | |              |  |  |      |  |             | ****      | |                  *****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..        | |       |  |         |  | |  |  |             |  | |  ***| |                   | |                ||||                             | |  |       |  |  |   |        | || |            |  | || |        | |              |  |  |      |  |             | |  |      | |                     | |
search RasMol script viewer Motif-ligand binding stats  nest ..        | |       |  |         |  ***  |  |             |  | |  |  | |                   | |                ****                             ***  |       |  |  |   |        | || |            |  | || |        ***              |  |  |      |  |             | |  |      | |                     ***
search RasMol script viewer Motif-ligand binding stats  niche ..        | |       ****         |    |  ****             **** ****  ***                   ***                                                   ****       ****  |   |        ******            *********                         *******      ****             ******      ***                        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..        | |                    ******                              | |                                                                                          |   |                                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..        | |                                                        | |                                                                                          *****                                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..        ***                                                        ***                                                                                                                                                                                                                                

chain B : MERLIN
member of: CATH:search1.20.80.10/search2.30.29.30/search3.10.20.90GENE3D:searchG3DSA_1.20.5.450/searchG3DSA_1.20.80.10/searchG3DSA_2.30.29.30/searchG3DSA_3.10.20.90PANTHER:searchPTHR23281/searchPTHR23281_SF17PFAM:searchPF00373/searchPF09379/searchPF09380PIRSF:searchPIRSF002305PRINTS:searchBAND41/searchERMFAMILYPROSITE PATTERNS:searchPS00660/searchPS00661, PROSITE PROFILES:searchPS50057, SMART:searchSM00295SUPERFAMILY:searchSSF47031/searchSSF50729/searchSSF54236UniProt:searchP35240
JMol viewer RasMol script viewer  SO4 1315B  ..                    *                                       *                                                                                                                                                                                                                                         
JMol viewer RasMol script viewer  SO4 1314B  ..                    |                                       |                                                               *                                                 **  *                                                                                                                   
sec str:  ...eeeeeee....eeeeeee...hhhhhhhhhhhhhh..hhh.eeeeeee..eeee......hhhh.......eeeeeee.....hhhhhh.hhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhh..................hhhhhhhh..hhhhhhhhhhhhhhh....hhhhhhhhhhhhhh.......eeeeeee....eeeeee...eeeee.........eeee...eeeeeee..eeeeee.......eeee..hhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..KTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETWFFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFLQVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMTPEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALGLHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKA
seq num:  ..20        30        40        50        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |  | |       |  |         || |||  || ||   ||||   | |  | |  |  | ||             | |  | |            |   |||||                     | |  | |||  |       |  |  |   |      |||||| | |      | | |  | || | |    |||||      | |     |  | || ||   |  ||^***|||  | || | ||     ^***                  |  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   | |  | |       |  |         || |||  || ||   ||||   | |  | |  |  | ||             | |  | |            |   |||||                     | |  | |||  |       |  |  |   |      |||||| | |      | | |  | || | |    |**^*      | |     |  | || ||   |  ||| | |||  | || | ||      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**  | |       |  |         || |||  || ||   ^**|   | |  | |  |  | ||             | |  | |            |   |||||                     | |  | |||  |       |  |  |   |      |||||| | |      | | |  | || | |    | |||      | |     |  | |^**|   |  ||| | ^**  ^**| | ||      ^**                  |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        | |       |  |         || |||  || ||   ^***   | |  | |  |  ^***             | |  | |            |   |||||                     | |  | |||  |       |  |  |   |      |||||| | |      | | |  | || | |    | |||      | |     |  | || ||   |  ||| ^***      | | ||      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        | |       |  |         || |||  || ||    |     | |  | |  |  | |              | |  | |            ********^                     | |  | |||  |       |  |  |   |      |||||| | *******^ ********^ | |    | |||      | |     |  | || ||   |  |||           | | ||      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        | |       |  |         || |^***** |^*****     | |  | |  |  | |              | |  | |                ||||                      | |  | |||  |       |  |  |   |      |||||| |            |  | || | |    | |||      | |     |  | || ||   |  |||           | | ||      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  FERM_1 ..        | |       |  |         || |||  |  |           ******************************* |  | |                ||||                      | |  | |||  |       |  |  |   |      |||||| |            |  | || | |    | |||      | |     |  | || ||   |  |||           | | ||      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  FERM_2 ..        | |       |  |         || |||  |  |             |  | |  |  | |                |  | |                ||||                      | |  | |||  |       |  |  |   |      |******************************    | |||      | |     |  | || ||   |  |||           | | ||      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..        | |       |  |         || |||  |  |             |  | |  |  | |                |  | |                ||||                      ***  | |||  |       |  |  |   |      | |||| |            |  | || |      | |||      ***     |  ***| ||   |  |||           | ***|      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..        | |       |  |         || |||  |  |             |  | |  |  | |                |  | |                ||||                           | |||  |       |  |  |   |      | |||| |            |  | || |      | |||              |  |  | **   |  |**           | |  |      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..        | |       |  |         || |||  |  |             |  | |  |  | |                |  | |                ||||                           | |||  |       |  |  |   |      | |||| |            |  | || |      *****              |  |  |      |  |             | |  |      | |                  |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |       ****         |****|  |  |             |  | |  |  | |                |  | |                ||||                           ****|  |       |  |  |   |      ********            **** || |      ****|              |  |  |      |  |             | |  |      | |                  ****  
search RasMol script viewer Motif-ligand binding stats  nest ..        | |       |  |         |  ***  |  |             |  | |  |  | |                |  | |                ****                             ***  |       |  |  |   |        | || |            |  | || |        ***              |  |  |      |  |             | |  |      | |                        
search RasMol script viewer Motif-ligand binding stats  niche ..        | |       ****         |    |  ****             **** ****  ***                ******                                                   ****       ****  |   |        ******            *********                         *******      ****             ******      ***                        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..        | |                    ******                                                                                                                           |   |                                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..        | |                                                                                                                                                     *****                                                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..        ***                                                                                                                                                                                                                                                                                           

   New search    1h4r:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors