triangle PDBeMotif: 1gn6  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.15.1.1
Classification oxidoreductase    | release date: Wed, Oct 3, 2001
Title g152a mutant of mycobacterium tuberculosis iron-superoxide dismutase.
Authors D.B.YOUNG, J.B.COOPER, K.A.BUNTING, M.O.BADASSO, P.T.ERSKINE, S.P.WOOD, S.SAWARD, Y.ZHANG
Method X-RAY DIFFRACTION (resolution: 2.90Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
MAEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAILLNEKNLAFNLAGHVNHTIWW
KNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFPLAIVPLLLLD
MWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATSQTKGLIFG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SUPEROXIDE DISMUTASE
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP9WGE6
JMol viewer RasMol script viewer  FE 999A  ..                          *                                               *                                                                                   *   *                                   
sec str:  ............hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee..........eeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhh.
sequence :  ..AEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAILLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFPLAIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATS
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |     |  |  |                  |    |        | |                 | ^*** |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     |  |  |                  |    |        | |                 |   |  |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |  |                  ^*****        | |                 |   |  |  || |                  |   |    || |||| ^*****      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  ||  ^***^***  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  **  | |       |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |      | |       ****       ****|        |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |                                ***                 |   |  |  || |                  |   |    || ||||             ***             |  |      | |                   |  |        |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..            *******                                                    |   |  ****| |                  |   |    || ****                             ****      ***                   ****        |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                       |   |      | |                  *****    ||  ||                                                                          |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                       *****      | |                           ******                                                                          ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                  ***                                                                                                                 

chain B : SUPEROXIDE DISMUTASE
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP9WGE6
JMol viewer RasMol script viewer  FE 999B  ..                          *                                               *                                                                                   *   *                                   
sec str:  ............hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee..........eeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhh.
sequence :  ..AEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAILLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFPLAIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATS
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |     |  |  |                  |    |        | |                 | ^*** |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     |  |  |                  |    |        | |                 |   |  |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |  |                  ^*****        | |                 |   |  |  || |                  |   |    || |||| ^*****      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  ||  ^***^***  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  **  | |       |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |      | |       ****       ****|        |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |                                ***                 |   |  |  || |                  |   |    || ||||             ***             |  |      | |                   |  |        |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..            *******                                                    |   |  ****| |                  |   |    || ****                             ****      ***                   ****        |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                       |   |      | |                  *****    ||  ||                                                                          |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                       *****      | |                           ******                                                                          ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                  ***                                                                                                                 

chain C : SUPEROXIDE DISMUTASE
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP9WGE6
JMol viewer RasMol script viewer  FE 999C  ..                          *                                               *                                                                                   *   *                                   
sec str:  ............hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee..........eeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhh.
sequence :  ..AEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAILLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFPLAIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATS
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |     |  |  |                  |    |        | |                 | ^*** |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     |  |  |                  |    |        | |                 |   |  |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |  |                  ^*****        | |                 |   |  |  || |                  |   |    || |||| ^*****      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  ||  ^***^***  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  **  | |       |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |      | |       ****       ****|        |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |                                ***                 |   |  |  || |                  |   |    || ||||             ***             |  |      | |                   |  |        |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..            *******                                                    |   |  ****| |                  |   |    || ****                             ****      ***                   ****        |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                       |   |      | |                  *****    ||  ||                                                                          |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                       *****      | |                           ******                                                                          ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                  ***                                                                                                                 

chain D : SUPEROXIDE DISMUTASE
member of: CATH:search1.10.287.990GENE3D:searchG3DSA_1.10.287.990PANTHER:searchPTHR11404/searchPTHR11404_SF6PFAM:searchPF00081/searchPF02777PIRSF:searchPIRSF000349PRINTS:searchMNSODISMTASEPROSITE PATTERNS:searchPS00088, SUPERFAMILY:searchSSF46609/searchSSF54719UniProt:searchP9WGE6
JMol viewer RasMol script viewer  FE 999D  ..                          *                                               *                                                                                   *   *                                   
sec str:  ............hhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....eeeeeeee..........eeeeeee.hhhhhhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhh.
sequence :  ..AEYTLPDLDWDYGALEPHISGQINELHHSKHHATYVKGANDAVAKLEEARAKEDHSAILLNEKNLAFNLAGHVNHTIWWKNLSPNGGDKPTGELAAAIADAFGSFDKFRAQFHAAATTVQGSGWAALGWDTLGNKLLIFQVYDHQTNFPLAIVPLLLLDMWEHAFYLQYKNVKVDFAKAFWNVVNWADVQSRYAAATS
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  |     |  |  |                  |    |        | |                 | ^*** |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***     |  |  |                  |    |        | |                 |   |  |  || |                  |   |    || |||| |    |      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            |  |  |                  ^*****        | |                 |   |  |  || |                  |   |    || |||| ^*****      | |             |  |  ||  | | |  |  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  SOD_MN ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  ||  ^***^***  |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |  **  | |       |  |       || ||        |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            |  |  |                                | |                 |   |  |  || |                  |   |    || ||||             | |             |  |      | |       ****       ****|        |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..            |  |  |                                ***                 |   |  |  || |                  |   |    || ||||             ***             |  |      | |                   |  |        |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..            *******                                                    |   |  ****| |                  |   |    || ****                             ****      ***                   ****        |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                       |   |      | |                  *****    ||  ||                                                                          |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                       *****      | |                           ******                                                                          ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                  ***                                                                                                                 

   New search    1gn6:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors