triangle PDBeMotif: 1gmo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification hormone    | release date: Thu, Sep 20, 2001
Title crystal structures of nk1-heparin complexes reveal the basis activity and enable engineering of potent agonists of the m receptor
Authors B.MULLOY, D.LIETHA, D.Y.CHIRGADZE, E.GHERARDI, T.L.BLUNDELL
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Small molecules:    search IDS IDS binding statistics IDS   search SGN SGN binding statistics SGN   search SO4 SO4 binding statistics SO4   search EPE EPE binding statistics EPE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F,G,H sequence:
YVEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSG
VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGP
WCFTSNPEVRYEVCDIPQCSEVE
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  SO4 1216B  ..                                                                                                                                                                            
JMol viewer RasMol script viewer  EPE 1216A  ..                                                                                                                             *                    **** * *      ** *        
JMol viewer RasMol script viewer  SO4 1215A  ..                                                                                                                             | *      ***         |||| | |      || |        
JMol viewer RasMol script viewer  SGN 1212A  ..                                                          *                                                                  | |      |||         |||| | |      || |        
JMol viewer RasMol script viewer  IDS 1211A  ..                        *                                 |                                                                  | |      |||         |||| | |      || |        
JMol viewer RasMol script viewer  SGN 1210A  ..                        |                                 |                                                                  | |      |||         |||| | |      || |        
JMol viewer RasMol script viewer  IDS 1209A  ..                       *|*                                |                                                                  | |      |||         |||| | |      || |        
sec str:  ...hhh.eeee..eeeee.......eeee..hhhhhhhhhhh.........eeeee....eeeee........eeeee...eeeeee.hhh......................................hhhhh...................eee.......eee........
sequence :  ..NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^*||||  | |    | | ||   | |       |  ||||||| ||||    |  | |      |  |  |    |  |    ||| |      ||||||| |  | |||   |  | |       | ||||||||  || | ||||||  ||||| |||       | ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |||||  ^**    | | ||   ^**       |  ||||||| |^**    |  | |      |  |  |    |  |    ||| |      |||^**| |  | |||   |  | |       | ^**|||||  || | ||||||  ||||| |||       | ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|         | | ||             |  ||||||| | |     |  | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       |  | |||||  || | ||||||  |||^***||       | ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ||| |         | | ||             |  |||||^*****     |  | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       |  | |||||  || | ||||^*****| | |||       |  |
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 .. ||| |         | | ||             |  ||||| | |       |  | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       |  | |||||  *^***********^ | | |||       |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ||| |         | | ||             |  ||||| | |       |  | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       |  | |||||  |  | |||| |    | *****       |  |
search RasMol script viewer Motif-ligand binding stats  asxturn .. ||| |         | ***|             |  ||||| | |       |  | |      |  |  |    |  |    *** |      ||||| | |  | |||   |  | |       |  | |||||  |  | |||| |    | ***|        |  |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. ||| |         | |  |             |  ||||| | |       ******      |  |  |    |  |     |  |      ||||| | |  *****   |  | |       |  | |||||  |  | |||| |    | |  |        |  |
search RasMol script viewer Motif-ligand binding stats  betaturn .. ||| |         | |  |             |  ****| | |          | |      *******    |  |     |  |      |**** | |  ****|   |  | |       *******||****  ********    | ****        ****
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ||| |         | |  |             |   |||| ***          | |      |  |  |    |  |     |  |      ||||| | |    | |   |  | |            ||***       | || |    | |  |            
search RasMol script viewer Motif-ligand binding stats  nest .. *** |         | |  |             |   |*** |            ***      |  |  |    |  |     |  |      ****| | |    ***   |  | |            ****        ***| |    | |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****         ******             |   | ****                     *******    ****     ****       **** ***          **** |                           ***    ******            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  *****                                                                              | |                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                     ***                                                    

chain B : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1225B  ..                                                                                                                             *                    **** * *      **          
JMol viewer RasMol script viewer  SO4 1216B  ..                                                                                         *  **  * **                         |                    |||| | |      ||          
JMol viewer RasMol script viewer  IDS 1211B  ..                                                                                         |  ||  | ||                         |                  * |||| | |      ||          
JMol viewer RasMol script viewer  SGN 1210B  ..                                                                                         |  ||  | ||                         |    *  *         ***|||| | |      ||          
JMol viewer RasMol script viewer  IDS 1209B  ..                                                                                         |  ||  | ||                         |    |***         ||||||| | |      ||          
sec str:  ...hhh.eeeee..eee........eeee..hhhhhhhhhhh.........eeeee....eeeee.........eee....eeeeee.hhh......................................hhhhh...................eee.......eee........
sequence :  ..NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^*| ||  | |      | | |  | |            |||||  |||       | |      |  |  |    |  |    ||| |      ||||||| |  | |||   |  |     | | | ||||||||  || | ||| |   ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||  ^**      | | |  ^**            |||||  ^**       | |      |  |  |    |  |    ||| |      |||^**| |  | |||   |  |     | | | ^**|||||  || | ||| |   ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|           | | |                 |||||   |        | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | | |  | |||||  || | ||| |   |||^***||         ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |           | | |                 |||^*****        | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | | |  | |||||  || | ||| ^*****| | |||           
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 ..  |  |           | | |                 ||| |            | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | | |  | |||||  *^***********^ | | |||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |           *****                 ||| |            | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | | |  | |||||  |  | |||       | *****           
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |           | |                   ||| |            | |      |  |  |    |  |    *** |      ||||| | |  | |||   |  |     | | |  | |||||  |  | |||       | ***|            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |           | |                   ||| |            | |      |  |  |    |  |     |  |      ||||| | |  *****   |  |     | | |  | |||||  |  | |||       | |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |           | |                   ||| |            | |      *******    ****     |  |      |**** | |  ****|   |  |     | | *******||****  ****|       | ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |           ***                   ||| |            | |      |  |  |    |  |     |  |      ||||| | |    | |   |  |     | |      ||||        | |       | |  |            
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                                 *** |            ***      |  |  |    |  |     |  |      ****| | |    ***   |  |     | |      ****        ***       | |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                  ****                     *******    ****     ****       **** ***          ****     ***                            ******            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1219C  ..                                                                                                                                                  **** * *      ** *        
JMol viewer RasMol script viewer  SGN 1218C  ..                                       *                                                                                                          |||| | |      || |        
JMol viewer RasMol script viewer  IDS 1217C  ..                                    *  |                                                                                                          |||| | |      || |        
JMol viewer RasMol script viewer  SGN 1216C  ..                                    *  | **                                                                                                       |||| | |      || |        
JMol viewer RasMol script viewer  IDS 1215C  ..                       *            *  | ||                                                                                                       |||| | |      || |        
JMol viewer RasMol script viewer  SGN 1214C  ..                       ****         |  | ||                                                                                                       |||| | |      || |        
JMol viewer RasMol script viewer  SO4 1209C  ..                       ||||         |  | ||                                                 **  * **                                              |||| | |      || |        
sec str:  ...hhh.eeeee...eee.......eeee..hhhhhhhhhhh.........eeeee....eeeee........eee.....eeeeee.hhh.....................................hhhhh....................eee.......eee........
sequence :  ..NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^*| ||  | |    | | ||   | |       | |||||||| ||||    | || |      | ||  |    |  |     |  |      ||||||| |  | |||   |  | |    | || ||||||||  || | ||||||  ||||| |||   | |   | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||  ^**    | | ||   ^**       | |||||||| |^**    | || |      | ||  |    |  |     |  |      |||^**| |  | |||   |  | |    | || ^**|||||  || | ||||||  ||||| |||   | |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|         | | ||             | |||||||| | |     | || |      | ||  |    |  |     |  |      ||||| | |  | |||   |  | |    | || || |||||  || | ||||||  |||^***||   | |   ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. || ||         | | ||             | ||||||^*****     | || |      | ||  |    |  |     |  |      ||||| | |  | |||   |  | |    | || || |||||  || | ||||^*****| | |||   | |     
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 .. || ||         | | ||             | |||||| | |       | || |      | ||  |    |  |     |  |      ||||| | |  | |||   |  | |    | || || |||||  *^***********^ | | |||   | |     
search RasMol script viewer Motif-ligand binding stats  asxmotif .. || ||         | | ||             | |||||| | |       | || |      | ||  |    |  |     |  |      ||||| | |  | |||   |  | |    | || || |||||  |  | |||| |    | *****   | |     
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||         | ***|             | |||||| | |       ***| |      ***|  |    |  |     |  |      ||||| | |  | |||   |  | |    | || || |||||  |  | |||| |    | ***|    | |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. || ||         | |  |             | |||||| | |          | |      |  |  |    |  |     |  |      ||||| | |  *****   |  | |    | || || |||||  |  | |||| |    | |  |    | |     
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|         | |  |             | |****| | |          | |      |  |  |    |  |     |  |      |**** | |  ****|   |  | |    | ***** ||||****  ********    | ****    | |     
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |         | |  |             | | |||| ***          | |      |  |  |    |  |     |  |      ||||| | |    | |   |  | |    ***     ||***       | || |    | |  |    ***     
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |         | |  |             | | |*** |            ***      |  |  |    |  |     |  |      ****| | |    ***   |  | |            ****        ***| |    | |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****         ******             | | | ****                     *******    ****     ****       **** ***          **** |                           ***    ******            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                  | ******                                                                           | |                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                  *****                                                                              | |                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                     ***                                                    

chain D : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1210D  ..                                                                                                                             *                    **** * *      **          
JMol viewer RasMol script viewer  SO4 1209D  ..                                                                                         *  **  ****                         |                    |||| | |      ||          
sec str:  ...hhh.eeeee..eeee........eee..hhhhhhhhhhhh........eeeee....eeeee........eeee....eeeeee.hhh.....................................hhhhh....................eee.......eee........
sequence :  ..NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^*| ||  | |             | |            | ||   ||||      | |      |  |  |    |  |    ||| |      ||||||| |  | |||   |  |        || |||||||   || | ||||||  ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||  ^**             ^**            | ||   ^**|      | |      |  |  |    |  |    ||| |      |||^**| |  | |||   |  |        || ^**||||   || | ||||||  ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|                                 | ||    |||      | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |        || || ||||   || | ||||||  |||^***||         ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. || ||                                 | |^*****||      | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |        || || ||||   || | ||||^*****| | |||           
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 .. || ||                                 | |      ||      | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |        || || ||||   *^***********^ | | |||           
search RasMol script viewer Motif-ligand binding stats  asxmotif .. || ||                                 | |      ||      | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |        || || ||||      | |||| |    | *****           
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||                                 | |      ||      | |      |  |  |    |  |    *** |      ||||| | |  | |||   |  |        || || ||||      | |||| |    | ***|            
search RasMol script viewer Motif-ligand binding stats  betabulge .. || ||                                 | |      **      | |      |  |  |    |  |     |  |      ||||| | |  | |||   |  |        || || ||||      | |||| |    | |  |            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. || ||                                 | |              | |      |  |  |    |  |     |  |      ||||| | |  *****   |  |        || || ||||      | |||| |    | |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|                                 | |              | |      *******    ****     ****      |**** | |  ****|   |  |        ********||      ****|| |    | ****            
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                                 ***              ***      |  |  |    |  |     |  |      ****| | |    ***   |  |              ****        ***| |    | |  |            
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                                           *******    ****     ****       **** ***          ****                             ***    ******            

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1211E  ..                                                                                                                                                *  *** *        ** *         
JMol viewer RasMol script viewer  SO4 1210E  ..                                                                                         *  **  ****                                            |  ||| |        || |         
sec str:  ...hhh.eeeeeeeeee........eeee..hhhhhhhhhhh.........eeeee....eeeee.........eeeeeeeeeeeee.hhh......................................hhhhh...................eee.......eee.........
sequence :  ..NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^*| ||  | |    | | ||   | |   |  || |||||||| ||||    | || |      |  |  |    |  |    |||||      ||||||| |  | |||   |  | |    | |  | ||||||  || | ||||||  ||||| |||       | || 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||  ^**    | | ||   ^**   |  || |||||||| |^**    | || |      |  |  |    |  |    |||||      |||^**| |  | |||   |  | |    | |  ^**|||||  || | ||||||  ||||| |||       | || 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|         | | ||         |  || |||||||| | |     | || |      |  |  |    |  |    |||||      ||||| | |  | |||   |  | |    | |     |||||  || | ||||||  |||^***||       | ^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |         | | ||         |  || ||||||^*****     | || |      |  |  |    |  |    |||||      ||||| | |  | |||   |  | |    | |     |||||  || | ||||^*****| | |||       |  | 
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 ..  |  |         | | ||         |  || |||||| | |       | || |      |  |  |    |  |    |||||      ||||| | |  | |||   |  | |    | |     |||||  *^***********^ | | |||       |  | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |         | | ||         *********||| | |       | || |      |  |  |    |  |    |||||      ||||| | |  | |||   |  | |    | |     |||||  |  | |||| |    | | |||       |  | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |         | | ||         |  || || ||| | |       | || |      |  |  |    |  |    *****      ||||| | |  | |||   |  | |    | |     |||||  |  | |||| |    | *****       |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |         | ***|         |  || || ||| | |       ***| |      |  |  |    |  |    ***||      ||||| | |  | |||   |  | |    | |     |||||  |  | |||| |    | ***|        |  | 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |         | |  |         |  || || ||| | |       ******      |  |  |    |  |    || ||      ||||| | |  *****   |  | |    | |     |||||  |  | |||| |    | |  |        |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |         | |  |         ***********| | |          | |      ****  |    |  |    ****|      |**** | |  ****|   |  | |    | |     ||||****  ********    | ****        |  | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |         | |  |               |  ||| ***          | |      |  |  |    |  |     |  |      ||||| | |    | |   |  | |    ***     ||***       | || |    | |  |        |  | 
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |         | |  |               |  *** |            ***      |  |  |    |  |     |  |      ****| | |    ***   |  | |            ****        ***| |    | |  |        |  | 
search RasMol script viewer Motif-ligand binding stats  niche ..  ****         ******               |   ****                     *******    ****     ****       **** ***          **** |                           ***    ******        **** 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                    ******                                                                           | |                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                     ***                                                     

chain F : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1218F  ..                                                                                                                                                  *    *         ***         
JMol viewer RasMol script viewer  SO4 1217F  ..                                                                                                                                  *** * *         |    |         |||         
JMol viewer RasMol script viewer  SO4 1216F  ..                                                                                         *  **  * *                               ||| | |         |    |         |||         
JMol viewer RasMol script viewer  IDS 1215F  ..                           *    *   *                                                    |  ||  | |                               ||| | |         |    |         |||         
JMol viewer RasMol script viewer  SGN 1214F  ..                           |    |   *    **                                              |  ||  | |                               ||| | |         |    |         |||         
JMol viewer RasMol script viewer  IDS 1213F  ..                         * |    |   *    ||                                              |  ||  | |                               ||| | |         |    |         |||         
JMol viewer RasMol script viewer  SGN 1212F  ..                       ****|    |   |    ||                                              |  ||  | |                               ||| | |         |    |         |||         
JMol viewer RasMol script viewer  SO4 1210E  ..                       |||||    |   |    ||                                              |  ||  | |                               ||| | |         |    |         |||         
sec str:  ...hhh.eeeee...ee........eeee..hhhhhhhhhhh.........eeeee....eeeee.........ee......eeeee.hhh..............................................................eee.......eee.........
sequence :  ..NTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEV
seq num:  ..37        47        57        67        77        87        97        107       117       127       137       147       157       167       177       187       197          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..^*| ||  | |      | |    | |   |  ||    | ||   |||       | |      |  |  |    |  |    ||| |      ||||||| |  | |||   |  |     | |   | ||||||  ||   | ||||  ||||| |||         |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||  ^**      | |    ^**   |  ||    | ||   ^**       | |      |  |  |    |  |    ||| |      |||^**| |  | |||   |  |     | |   ^**|||||  ||   | ||||  ||||| |||         |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ^***|           | |          |  ||    | ||    |        | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | |      |||||  ||   | ||||  |||^***||         ^**
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  |  |           | |          |  ||    | |^*****        | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | |      |||||  ||   | ||^*****| | |||            
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 ..  |  |           | |          |  ||    | |              | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | |      |||||  *^***********^ | | |||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |           | |          *****    | |              | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | |      |||||  |    | || |    | | |||            
search RasMol script viewer Motif-ligand binding stats  asxmotif ..  |  |           | |          |  |     | |              | |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  |     | |      |||||  |    | || |    | *****            
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  |           | |          |  |     | |              | |      |  |  |    |  |    *** |      ||||| | |  | |||   |  |     | |      |||||  |    | || |    | ***|             
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  |           | |          |  |     | |              | |      |  |  |    |  |     |  |      ||||| | |  *****   |  |     | |      |||||  |    | || |    | |  |             
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  |           | |          ****     | |              | |      *******    ****     |  |      |**** | |  ****|   |  |     | |      ||||****    | ****    | ****             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |           ***                   | |              | |      |  |  |    |  |     |  |      ||||| | |    | |   |  |     | |      ||||        | || |    | |  |             
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                                 ***              ***      |  |  |    |  |     |  |      ****| | |    ***   |  |     | |      ****        ***| |    | |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                                                           *******    ****     ****       **** ***          ****     ***                     ***    ******             
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                          ***                

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain G : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1215G  ..             ..                                                                                                        *                    ** * * *      **          
JMol viewer RasMol script viewer  IDS 1214G  ..             ..               *                                                                                        |                    || | | |      ||          
JMol viewer RasMol script viewer  SGN 1213G  ..             ..               *     *                                                                                  |                    || | | |      ||          
JMol viewer RasMol script viewer  IDS 1212G  ..             ..               *     |                                                                                  |                    || | | |      ||          
JMol viewer RasMol script viewer  SGN 1211G  ..             ..  ****         |     |                                                                                  |                    || | | |      ||          
sec str:  ..hhh.eeeeeeee.....eeee..hhhhhhhhhhh.........eeeee....eeeee...........eeeeeeeeeee.hhh......................................hhhhh...................eee.......eee........
sequence :  ..TIHEFKKSAKTTL..KIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
seq num:  ..38        48 ..58        68        78        88        98        108       118       128       138       148       158       168       178       188       198        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*| ||  | |   ..   | |       | |||||||| ||||    | || |      |  |  |    |  |    ||| |      ||||||| |  | |||   |  | |       ||||||||| | ||   | ||||  ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||  ^**   ..   ^**       | |||||||| |^**    | || |      |  |  |    |  |    ||| |      |||^**| |  | |||   |  | |       ||^**|||| | ||   | ||||  ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|        ..             | |||||||| | |     | || |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       || |||||| | ||   | ||||  |||^***||         ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|| ||        ..             | ||||||^*****     | || |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       || |||||| | ||   | ||^*****| | |||           
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 ..|| ||        ..             | |||||| | |       | || |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       || |||||| | *^***********^ | | |||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|| ||        ..             | |||||| | |       | || |      |  |  |    |  |    ||| |      ||||| | |  | |||   |  | |       || |||||| | |    | || |    | *****           
search RasMol script viewer Motif-ligand binding stats  asxturn ..|| ||        ..             | |||||| | |       ***| |      |  |  |    |  |    *** |      ||||| | |  | |||   |  | |       || |||||| | |    | || |    | ***|            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..|| ||        ..             | |||||| | |       ******      |  |  |    |  |     |  |      ||||| | |  *****   |  | |       || |||||| | |    | || |    | |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn ..****|        ..             | |****| | |          | |      |  |  |    ****     |  |      |**** | |  ****|   |  | |       *******|| | |    | ****    | ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |        ..             | | |||| ***          | |      |  |  |    |  |     |  |      ||||| | |    | |   |  | |        |  ||||| | |    | || |    | |  |            
search RasMol script viewer Motif-ligand binding stats  nest .. |  |        ..             | | |*** |            ***      |  |  |    |  |     |  |      ****| | |    ***   |  | |        |  |**** | |    ***| |    | |  |            
search RasMol script viewer Motif-ligand binding stats  niche .. ****        ..             | | | ****                     *******    ****     ****       **** ***          **** |        ****     ***       ***    ******            
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..             ..             | ******                                                                           | |                                                    
search RasMol script viewer Motif-ligand binding stats  ststaple ..             ..             *****                                                                              | |                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..             ..                                                                                                ***                                                    

chain H : HEPATOCYTE GROWTH FACTOR
member of: CATH:search2.40.20.10/search3.50.4.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_3.50.4.10PANTHER:searchPTHR24272/searchPTHR24272_SF3PFAM:searchPF00024/searchPF00051PIRSF:searchPIRSF001152/searchPIRSF500183PRINTS:searchKRINGLEPROSITE PATTERNS:searchPS00021, PROSITE PROFILES:searchPS50070/searchPS50948, SMART:searchSM00130/searchSM00473SUPERFAMILY:searchSSF57414/searchSSF57440UniProt:searchP14210
JMol viewer RasMol script viewer  EPE 1210H  ..                                                                                                                            *                    * ** * *      ** *        
JMol viewer RasMol script viewer  SO4 1209H  ..                                                                                                                            |     ** * *         | || | |      || |        
sec str:  ..hhh.eeeee..eee........eeee..hhhhhhhhhhh.........eeeee....eeeee.........eee....eeeeee.hhh..............................................................eee.......eee........
sequence :  ..TIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCADRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSE
seq num:  ..38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198        
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..*| ||  | |      | |    | |       |   ||||||  ||||               |  |  |    |  |    |||||      ||||||| |  | |||   |  | |         ||||||||  || | ||| |   ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|| ||  ^**      | |    ^**       |   ||||||  ^**|               |  |  |    |  |    |||||      |||^**| |  | |||   |  | |         ^**|||||  || | ||| |   ||||| |||         | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^***|           | |              |   ||||||   |||               |  |  |    |  |    |||||      ||||| | |  | |||   |  | |          | |||||  || | ||| |   |||^***||         ^*
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |           | |              |   ||||^*****||               |  |  |    |  |    |||||      ||||| | |  | |||   |  | |          | |||||  || | ||| ^*****| | |||           
search RasMol script viewer Motif-ligand binding stats  KRINGLE_1 .. |  |           | |              |   |||| |    ||               |  |  |    |  |    |||||      ||||| | |  | |||   |  | |          | |||||  *^***********^ | | |||           
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |           | |              |   |||| |    ||               |  |  |    |  |    *****      ||||| | |  | |||   |  | |          | |||||  |  | |||       | *****           
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |           | |              |   |||| |    ||               |  |  |    |  |    ***||      ||||| | |  | |||   |  | |          | |||||  |  | |||       | ***|            
search RasMol script viewer Motif-ligand binding stats  betabulge .. |  |           | |              |   |||| |    **               |  |  |    |  |    || ||      ||||| | |  | |||   |  | |          | |||||  |  | |||       | |  |            
search RasMol script viewer Motif-ligand binding stats  betabulgeloop .. |  |           | |              |   |||| |                     |  |  |    |  |    || ||      ||||| | |  *****   |  | |          | |||||  |  | |||       | |  |            
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |           | |              |   |||| |                     *******    ****    ****|      |**** | |  ****|   |  | |          ****||****  ****|       | ****            
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |           ***              |   |||| |                     |  |  |    |  |     |  |      ||||| | |    | |   |  | |            ||||        | |       | |  |            
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                            |   |*** |                     |  |  |    |  |     |  |      ****| | |    ***   |  | |            ****        ***       | |  |            
search RasMol script viewer Motif-ligand binding stats  niche .. ****                            |   | ****                     *******    ****     ****       **** ***          **** |                                  ******            
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 *****                                                                              | |                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                    ***                                                    

   New search    1gmo:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors