triangle PDBeMotif: 1gk4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification vimentin    | release date: Wed, Aug 8, 2001
Title human vimentin coil 2b fragment (cys2)
Authors H.HERRMANN, N.GEISLER, P.BURKHARD, R.ZIMBELMANN, S.V.STRELKOV, U.AEBI
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search ACT ACT binding statistics ACT
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D,E,F sequence:
CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGE
ESRI
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : VIMENTIN
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23239/searchPTHR23239_SF27PFAM:searchPF00038PROSITE PATTERNS:searchPS00226, SUPERFAMILY:searchSSF64593UniProt:searchP08670
JMol viewer RasMol script viewer  ACT 1407B  ..                                                    *                          
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
seq num:  ..328       338       348       358       368       378       388       398      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | ^***                                                        | | | | ||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |    |                                                        | ^** | ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ^*****                                                        |     | ||
search RasMol script viewer Motif-ligand binding stats  IF ..                                                                     *********|
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..                                                                           |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                                           ****

chain B : VIMENTIN
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23239/searchPTHR23239_SF27PFAM:searchPF00038PROSITE PATTERNS:searchPS00226, SUPERFAMILY:searchSSF64593UniProt:searchP08670
JMol viewer RasMol script viewer  ACT 1407B  ..                                                   *  *                        
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....
sequence :  ..CEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
seq num:  ..328       338       348       358       368       378       388       398      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | ^***                                        |  ||           | | ||| | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |    |                                        |  ||           | ^**|| | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       ^*****                                        |  ||           | |  || | 
search RasMol script viewer Motif-ligand binding stats  IF ..                                                     |  ||           ********* 
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..                                                     |  ||             |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                                                     *****             *****   
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                     ****              ****    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : VIMENTIN
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23239/searchPTHR23239_SF27PFAM:searchPF00038PROSITE PATTERNS:searchPS00226, SUPERFAMILY:searchSSF64593UniProt:searchP08670
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.
sequence :  ..NESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
seq num:  ..337       347       357       367       377       387       397       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***  |                                   |  ||             | | ||| | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |                                   |  ||             | ^**|| | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  |                                   |  ||             | |  || | 
search RasMol script viewer Motif-ligand binding stats  IF ..  |   |                                   |  ||             ********* 
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..  |   |                                   |  ||               |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |   |                                   *****               *****   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |   |                                   ****                ****    
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****                                                               

chain D : VIMENTIN
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23239/searchPTHR23239_SF27PFAM:searchPF00038PROSITE PATTERNS:searchPS00226, SUPERFAMILY:searchSSF64593UniProt:searchP08670
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..VDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGE
seq num:  ..330       340       350       360       370       380       390       400     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | ^***                   |  ||                                | | ||  |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |    |                   |  ||                                | ^**|  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     ^*****                   |  ||                                |    |  |  
search RasMol script viewer Motif-ligand binding stats  IF ..                              |  ||                                *********  
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..                              |  ||                                     |  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                              *****                                     |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                              ****                                      ****  

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain E : VIMENTIN
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23239/searchPTHR23239_SF27PFAM:searchPF00038PROSITE PATTERNS:searchPS00226, SUPERFAMILY:searchSSF64593UniProt:searchP08670
sec str:  ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..NESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
seq num:  ..337       347       357       367       377       387       397       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..^***  |                                                     | | |   | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  ||  |                                                     | ^**   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  |                                                     |       | 
search RasMol script viewer Motif-ligand binding stats  IF ..  |   |                                                     ********* 
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..  |   |                                                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..  *****                                                               

chain F : VIMENTIN
member of: CATH:search1.20.5.170GENE3D:searchG3DSA_1.20.5.170PANTHER:searchPTHR23239/searchPTHR23239_SF27PFAM:searchPF00038PROSITE PATTERNS:searchPS00226, SUPERFAMILY:searchSSF64593UniProt:searchP08670
sec str:  ..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..
sequence :  ..LKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEG
seq num:  ..333       343       353       363       373       383       393       403 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | ^***                |   |                                   | | |   | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | |                |   |                                   | ^**   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****                |   |                                   |       | 
search RasMol script viewer Motif-ligand binding stats  IF ..  |  |                  |   |                                   ********* 
search RasMol script viewer Motif-ligand binding stats  MICROBODIES_CTER ..  |  |                  |   |                                             
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                  |   |                                             
search RasMol script viewer Motif-ligand binding stats  ststaple ..                        *****                                             

   New search    1gk4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors