triangle PDBeMotif: 1gii  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.37
Classification transferase    | release date: Tue, Feb 6, 2001
Title human cyclin dependent kinase 2 complexed with the cdk4 inhibitor
Authors M.IKUTA, S.NISHIMURA
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search 1PU 1PU binding statistics 1PU
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVF
EHVHQDLKTFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTYT
HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CELL DIVISION PROTEIN KINASE 2
member of: CATH:search1.10.510.10/search3.30.200.20GENE3D:searchG3DSA_1.10.510.10/searchG3DSA_3.30.200.20PANTHER:searchPTHR24056/searchPTHR24056_SF168PFAM:searchPF00069PROSITE PATTERNS:searchPS00107/searchPS00108, PROSITE PROFILES:searchPS50011, SMART:searchSM00220SUPERFAMILY:searchSSF56112UniProt:searchP24941
JMol viewer RasMol script viewer  1PU 501A  ..         *       *            *    ..                    *               * **  *                                            *  *          *       ..                                                                                                                                       
sec str:  .....eeeeeeeee....eeeeeee.....eeeeeee...hhhhhhhhhhhhhh.......eeeeeee..eeeeeee...eehhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhh.......hhh.eee.....eee...hhhhhh........hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh........hhhhh.............hhhhhh...hhhhhhhhhhhh........hhhhhhhhhhhh...........
sequence :  ..MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKI..VPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEHVHQDLKTFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAF..VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
seq num:  ..1         11        21        31   ..44        54        64        74        84        94        104       114       124       134       144      ..164       174       184       194       204       214       224       234       244       254       264       274       284       294  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |    ||    |       | || |    |  .. |  ||   | |  | |  |   ||   |  |             |  |                     |    ||||| | | || || |  | |  |  || |  |.. ||  |     | |   ||| |    |    |  | |      |  ||  |   |  | ||  | ||||| |||  |      | |   | || |      |  | |||**^* | |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |    ||    |       | || |    |  .. |  ||   | |  | |  |   ||   |  |             |  |                     |    |^**| | | || || |  | |  |  || |  |.. ||  |     | |   ||| |    |    |  ^**      |  ||  |   |  | ||  | ||||| |||  |      | |   | || |      |  | ||||| ^** |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |    ||    |       | || |    |  .. |  ||   | |  | |  |   ||   |  |             ^***                     |    | ||| | | || || |  | |  |  || |  |.. ||  |     | |   |^***    |    |  | |      ^***|  |   |  ^***  | |||^***||  |      | |   | || |      |  | ||||| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..|  |    ******^       | || |    |  .. |  ||   | |  | |  |   ||   |  |                                      |    | ||| | | || || |  | |  |  || |  |.. ||  |     | |   | |      |    |  | |      |   |  |   |    |   | ||| |  ||  |      | |   | || |      |  | ||||| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |     |            | || |    |  ..*****|   | |  | |  |   ||   |  |                                      ^***** ||| | | || || |  | |  |  |^*****.. ||  |     | |   | |      ^*****  | |      |   |  |   |    |   | ||| |  ||  |      | |   | || |      |  | ||||| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ATP ..|  |     ************************  .. |  ||   | |  | |  |   ||   |  |                                           | ||| | | || || |  | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |    |   | ||| |  ||  |      | |   | || |      |  | ||||| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  PROTEIN_KINASE_ST ..|  |                  | || |       .. |  ||   | |  | |  |   ||   |  |                                           | ||****^********  | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |    |   | ||| |  ||  |      | |   | || |      |  | ||||| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |                  | || |       .. *****   | |  | |  |   ||   |  |                                           | ||| | | || ||    | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |    |   | ||| |  ||  |      | |   | || |      |  | ***** |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |                  | || |       .. |  ||   | |  | |  |   ||   |  |                                           | ||| | | || ||    | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |    ***** ||| |  ||  |      | |   | || |      |  | ***** |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |                  ***| |       .. |  ||   | |  | |  |   ||   |  |                                           | ||| | | || ||    | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |        | ||| |  ||  |      ***   | |***      |  | ***|| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  betabulge ..|  |                  |  | |       .. |  ||   | |  | |  |   **   |  |                                           | ||| | | || ||    | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |        | ||| |  ||  |            | |         |  | || || |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..|  |                  ******       .. |  ||   | |  | |  |        |  |                                           | ||| | | || ||    | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |        | ||| |  ||  |            | |         |  | || || |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |                     | |       .. ****|   | |  | |  |        ****                                           ****| | | || ||    | |  |  || |   .. ||  |     | |   | |              | |      |   |  |   |        ****| |  ||  |            | |         |  | ****| |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..|  |                     ***       ..     |   | |  | |  |                                                         *** *** || ||    ***  |  |***   .. ||  |     ***   | |              ***      |   |  |   |          *** |  ||  |            | |         |  | ||  | |   |  |  |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..****                     | |       ..     |   | **** ****                                                               | |****         ****      .. |****           | |              | |      |   |  |   |           ***********            ***         ********** |   ****  ****         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         | |       ..     |   |                                                                         | |  |                    .. |               | |              | |      *****  |   |                                                         *****                  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |       ..     *****                                                                         | |  |                    .. |               | |              | |             *****                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***       ..                                                                                   | |  |                    .. |               ***              ***                                                                                                  
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                   ..                                                                                   * *  *                    .. *                                                                                                                                     

   New search    1gii:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML