triangle PDBeMotif: 1ggz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification metal binding protein    | release date: Fri, Oct 13, 2000
Title crystal structure of the calmodulin-like protein (hclp) from human epithelial cells
Authors B.-G.HAN, B.K.JAP, H.SUI, M.HAN, P.J.WALIAN, P.YASWEN
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTD
NEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CALMODULIN-RELATED PROTEIN NB-1
member of: CATH:search1.10.238.10GENE3D:searchG3DSA_1.10.238.10PANTHER:searchPTHR23050/searchPTHR23050_SF155PFAM:searchPF00036/searchPF13405PROSITE PATTERNS:searchPS00018, PROSITE PROFILES:searchPS50222, SMART:searchSM00054SUPERFAMILY:searchSSF47473UniProt:searchP27482
JMol viewer RasMol script viewer  CA 152A  ..                                                                                                                             * * * *            
JMol viewer RasMol script viewer  CA 151A  ..                                                                                         * * * *                             | | | |            
JMol viewer RasMol script viewer  CA 150A  ..                                                    * *   *    *                         | | | |                             | | | |            
JMol viewer RasMol script viewer  CA 149A  ..                * * * *                             | |   |    |                         | | | |                             | | | |            
sec str:  ...hhhhhhhhhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhh........eehhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....eehhhhhhhhhhhh....hhhhhhhhhhhhh......eehhhhhhhhhh
sequence :  ..LTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVS
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |   |  |    |  | ||||| | |||   || |||  || ||   || || ||^***|  ||          |  |          | ||||| |  ||   || |||  |  ||       ||||||| |  ||      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |   |  |    |  | ||||| ^**||   || |||  || ||   || || ||||| |  ||          |  |          | ||||| |  ||   || |||  |  ||       ||||||| |  ||      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |   |  |    ^*** ||||| ^***|   || |||  ^***|   |^*** ||||| |  ||          ^***          | ||||| ^***|   || |||  ^***|       |^***|| |  ||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |   |  |       | |||^*****||   || |^*****  |   |  || ||||| |  ||                        | ||||| |  ||   || |||  |   |       | ||||| |  ||      
search RasMol script viewer Motif-ligand binding stats  EF_HAND_1 .. |   |  |       ^*^*^*^*^**^*   || |||  |   |   |  |^*^*^*^*^**^*                        ^*^*^*^*^**^*   || |||  |   |       ^*^*^*^*^**^*      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |   |  |       | |||||         || |||  |   |   ***** ||||| |   |                        | ||||| |   |   || |||  |   |         |||||            
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |   |  |       | |||||         || |||  |   |   |  |  ||||| *****                        | ||||| |   |   || |||  |   |         |||||            
search RasMol script viewer Motif-ligand binding stats  betaturn .. |   |  |       ****|||         *****|  |   |   ****  |||||                              ****||| |   |   |****|  |   |         |||||            
search RasMol script viewer Motif-ligand binding stats  nest .. |   |  |         *****         |  ***  |   |         *****                                ***** |   |   |  ***  |   |         *****            
search RasMol script viewer Motif-ligand binding stats  schellmannloop .. |   |  |                       ******  |   |                                                    |   |   ******  |   |                          
search RasMol script viewer Motif-ligand binding stats  stmotif .. *****  |                               *****                                                    *****           *****                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..        *                                                                                                                                       

   New search    1ggz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML