triangle PDBeMotif: 1gen  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.24.24
Classification hydrolase (metalloprotease)    | release date: Wed, Jul 19, 1995
Title c-terminal domain of gelatinase a
Authors A.G.GITTIS, A.M.LIBSON, B.L.MARMER, E.E.LATTMAN, G.G.GOLDBERG, I.E.COLLIER
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search CA CA binding statistics CA   search NA NA binding statistics NA   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
ELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDA
VYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGF
PKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : GELATINASE A
member of: CATH:search2.110.10.10GENE3D:searchG3DSA_2.110.10.10/searchG3DSA_3.40.390.10PANTHER:searchPTHR10201/searchPTHR10201_SF29PFAM:searchPF00045/searchPF00413PRINTS:searchMATRIXINPROSITE PATTERNS:searchPS00024, PROSITE PROFILES:searchPS51642, SMART:searchSM00120/searchSM00235SUPERFAMILY:searchSSF50923/searchSSF55486UniProt:searchP08253
JMol viewer RasMol script viewer  NA 304A  ..                 *                                            *                                               *                                                *                                        
JMol viewer RasMol script viewer  CL 303A  ..                **                                           **                                              **                                               **                                        
JMol viewer RasMol script viewer  CA 302A  ..               *||                                           ||                                              ||                                              *||                                        
JMol viewer RasMol script viewer  ZN 301A  ..               |||                                           ||                                              ||                                              |||       *            *                   
sec str:  ..................eeeee..eeeeee..eeeee............hhh..........eeeee....eeeeee..eeeee............hhhh..........eeeee....eeeeee..eeeee..............hhhh.........eeee.....eeeeee..eeeeee..eeeeeeeeehhhh....
sequence :  ..LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC
seq num:  ..461       471       481       491       501       511       521       531       541       551       561       571       581       591       601       611       621       631       641       651       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |          |  |    |  |     | ||       |  ||  |         || |||    |  |    |||| |  |  ||||||||  |       ^***                  | | |  |   || ||  |       |   || | |          |^***|| | || | | | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |          |  |    |  |     ^**|       |  ||  |         || |||    |  |    |||| |  |  ||||||||  |                             | | |  |   || ||  |       |   || | |          |  ^**^** |^** | | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |          |  |    |  |     ^***       |  ||  |         || |||    |  |    ||^***  |  ||||||||  |                             | | |  |   || ||  |       |   || | |          |  |  |   |    | | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |          |  |    |  |     |  |       |  ||  |         || |||    |  |    || | |  |  ||||||||  |                             | | |  |   || ||  |       |   ^*****          |  |  |   ^***** | |
search RasMol script viewer Motif-ligand binding stats  HEMOPEXIN ..       | |          |  |    |  |     |  |       |  ||  |         || |||    |  |    || | |  |  ||||||||  |                             | | |  |   ****************    | |            |  |  |          | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |          |  |    |  |     |  |       *****  |         || |||    |  |    || | |  |  ||||||||  |                             | | |  |   *****  |            | |            |  |  |          | |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..       | |          |  |    |  |     |  |       |  ||  |         ******    |  |    || | |  |  ||||||||  |                             | | |  |   || ||  |            | |            |  |  |          | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..       | |          ****    ****     ****       ****|  |         |****|    ****    **** ****  ******||  |                             | | |  |   ****|  |            | |            *******          | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       ***                           |  |           |  |         |  | |             | |        |  | ||  |                             | | |  |    |  |  |            | |               |  |          | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                     |  |           |  |         |  ***             | |        |  ***|  |                             *** |  |    |  |  |            ***               |  |          ***
search RasMol script viewer Motif-ligand binding stats  niche ..                                     ****           ****         |    |             ***        |    |****                                 ****    *******                              ****             
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                 ******                        ******                                                                                                   

   New search    1gen:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors