triangle PDBeMotif: 1g88  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification transcription    | release date: Thu, Nov 16, 2000
Title s4afl3arg515 mutant
Authors B.M.CHAKO, B.QIN, J.J.CORREIA, K.LIN, S.S.LAM
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
NGHLQHHPPMPPHPGHYWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCL
GQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCH
RQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPSQSIKETPCW
IEIHLHRALQLLDEVLHTMPIADPQPLD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : SMAD4
member of: CATH:search2.60.200.10GENE3D:searchG3DSA_2.60.200.10PANTHER:searchPTHR13703/searchPTHR13703_SF33PFAM:searchPF03166PROSITE PROFILES:searchPS51076, SMART:searchSM00524SUPERFAMILY:searchSSF49879UniProt:searchQ13485
sec str:  .....eeee..................eeeeeeeee..ee....eeee....eeeee.........eee.........hhhhhhhhh.....eeeeee...eeeeee.....eeeehhhhhhhh.......eeee....eeeeehhhhhhhhhhhhhhhhhhh...... ......hhhhhh...eeeeee...........hhhhh..eeeeeehhhhhhhhhhh.....
sequence :  ..NGHLQHHPPMPP..QPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAA... ..AAGIGVDDLRRLCILRMSFVKGWGPDYPSQSIKETPCWIEIHLHRALQLLDEVLHTMPI
seq num:  ..285         ..311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       ... ..487       497       507       517       527       537      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |        ..    | |                    ^**          | | | |  |   || | || ||   | |  ||  |              | |           || ||||  |     |  |   ||                |  |  ..PS00005..    |  |||||||    | |  |  | | ^**||                        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |        ..    | |                                 | | | ^***   || | || ||   | |  ||  |              | |           || ||||  |     |  |   ||                |  |  ..PS00006..    |  |||||||    | |  |  | | ^***|                        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |        ..    | |                                 | | | |      |^***** ||   | |  ||  |              | |           || ||||  |     |  |   ||                |  |  ..PS00008..    |  |||||||    | |  |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |        ..    | |                                 *** | |      |  | |  ||   | |  ||  |              | |           || ||||  |     |  |   ||                |  |  ..asxturn..    |  |||||||    | |  |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |        ..    | |                                     | |      |  | |  ||   | |  ||  |              | |           || ||||  |     |  |   **                |  |  ..betabulge..    |  |||||||    | |  |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |        ..    | |                                     | |      |  | ****|   | ********              | |           |****|****     ****                     ****  ..betaturn..    *********|    | |  |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |        ..    | |                                     | |      |  | |  ||   |                       | |           |  | |         |  |                           ..gammaturn..          |  |    ***  |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  nest .. ***        ..    | |                                     | |      |  | |  ||   |                       | |           |  ***         |  |                           ..nest..          |  |         |  | |  |  |                        
search RasMol script viewer Motif-ligand binding stats  niche .. ***        ..    ***                                     ***      **** ****|   |                       ***           |    |         ****                           ..niche..          ****         ******  ****                        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..            ..                                                              |   |                                     ******                                        ..schellmannloop..                                                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..            ..                                                              *****                                                                                   ..stmotif..                                                           

chain B : SMAD4
member of: CATH:search2.60.200.10GENE3D:searchG3DSA_2.60.200.10PANTHER:searchPTHR13703/searchPTHR13703_SF33PFAM:searchPF03166PROSITE PROFILES:searchPS51076, SMART:searchSM00524SUPERFAMILY:searchSSF49879UniProt:searchQ13485
sec str:  .....eeee....................eeeeeeeee..ee....eeee....eeeee.........eee.........hhhhhhhhhhhh..eeeeee...eeeeee.....eeeehhhhhhhh.......eeee....eeeeehhhhhhhhhhhhhhhhhhhhhhhhhhhh... ..............hhhhhh...eeeee............hhhhh..eeeeeehhhhhhhhhhhh.........
sequence :  ..NGHLQHHPPMPP..AFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVA... ..APAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPSQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQP
seq num:  ..285         ..309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459     ... ..479       489       499       509       519       529       539         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||||        ..      | |                    ^** |  |     | | | |  |   || | || || |   |  ||  |              | | |     |   || ||||  |     |  |   ||                            ..PS00005..        | | | |  || ||    | |  |  | | ^**||                 || || | |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||||        ..      | |                        |  |     | | | ^***   || | || || |   |  ||  |              | | |     |   || ||||  |     |  |   ||                            ..PS00006..        | | | |  || ||    | |  |  | | ^***|                 || || | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..||||        ..      | |                        |  |     | | | |      |^***** || |   |  ||  |              | | |     |   || ||||  |     |  |   ||                            ..PS00008..        | | | |  || ||    | |  |  | |  |  |                 || || | |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..||||        ..      | |                        |  |     *** ***      |  | |  || |   |  ||  |              | | |     |   || ||||  |     |  |   ||                            ..asxturn..        | | | |  || ||    | |  |  | |  |  |                 || || | |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..||||        ..      | |                        |  |       | |        |  | |  || |   |  ||  |              | | |     |   || ||||  |     |  |   **                            ..betabulge..        | | | |  || ||    | |  |  | |  |  |                 || || | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..||||        ..      | |                        ****       | |        |  | ****| |   ********              | | |     |   *****|****     ****                                 ..betaturn..        | | | |  ****|    | |  **** |  ****                 ****| | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***|        ..      | |                                   | |        |  | |  || |                         | | |     |   |  | |         |  |                                 ..gammaturn..        *** | |   |  |    ***  |  | |  |  |                  |  | ***   
search RasMol script viewer Motif-ligand binding stats  nest .. | |        ..      | |                                   | |        |  | |  || |                         | | |     |   |  ***         |  |                                 ..nest..            ***   |  |         |  | |  |  |                  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***        ..      ***                                   ***        **** ****| |                         *****     |   |              ****                                 ..niche..                  ****         ******  ****                  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..            ..      | |                                                       | |                           | |     *****                                                   ..stmotif..                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..            ..      ***                                                       ***                           ***                                                             ..stturn..                                                                        

chain C : SMAD4
member of: CATH:search2.60.200.10GENE3D:searchG3DSA_2.60.200.10PANTHER:searchPTHR13703/searchPTHR13703_SF33PFAM:searchPF03166PROSITE PROFILES:searchPS51076, SMART:searchSM00524SUPERFAMILY:searchSSF49879UniProt:searchQ13485
sec str:  .....eeee...............eeeeeeeee..ee....eeee....eeeee.........eee.........hhhhhhhhhh....eeeeee...eeeeee.....eeeehhhhhhhh.......eeee....eeeeehhhhhhhhhhhhhhhhhhhhhhhhh..... ..............hhhhhhhh.eeeee............hhhhh..eeeeeehhhhhhhhhhhh.........
sequence :  ..NGHLQHHPPM..PPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAV... ..APAISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPSQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQP
seq num:  ..285       ..312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462 ... ..479       489       499       509       519       529       539         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |      ..   | |            |  |    ^** |  |     | | | |  |   || | |||||         |  |              | | |     | | |  | ||  |     |  |   |||   |     |   |    |  ||   ..PS00005..|| |    |  || | ||||||    | |  |  | | ^**||            |  || |  |       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |      ..   | |            |  |        |  |     | | | ^***   || | |||||         |  |              | | |     | | |  | ||  |     |  |   |||   |     |   |    |  ||   ..PS00006..|| |    |  || | ||||||    | |  |  | | ^***|            |  || |  |       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |      ..   | |            |  |        |  |     | | | |      |^*****|||         |  |              | | |     | | |  | ||  |     |  |   |||   |     |   |    |  ||   ..PS00008..|| |    |  || | ||||||    | |  |  | | || ||            |  || |  |       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |      ..   | |            |  |        |  |     | | | |      |  | | |||         |  |              | | |     | | |  | ||  |     |  |   |||   |     |   |    *****   ..alphabetamotif..|| |    |  || | ||||||    | |  |  | | || ||            ***** |  |       
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |      ..   | |            |  |        |  |     | | | |      |  | *****         |  |              | | |     | | |  | ||  |     |  |   ||*****     |   |    |  |    ..asxmotif..|| |    |  || | ||||||    | |  |  | | || ||            |  |  |  |       
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |      ..   | |            |  |        |  |     *** ***      |  | ***|          |  |              | | |     | | |  | ||  |     |  |   ||          |   |    |  |    ..asxturn..|| |    |  || | ||||||    | |  |  | | || ||            |  |  |  |       
search RasMol script viewer Motif-ligand binding stats  betabulge .. | |      ..   | |            |  |        |  |       | |        |  | |  |          |  |              | | |     | | |  | ||  |     |  |   **          |   |    |  |    ..betabulge..|| |    |  || | ||||||    | |  |  | | || ||            |  |  |  |       
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |      ..   | |            ****        ****       | |        |  | ****          ****              | | |     | | |  | |****     ****               |   |    ****    ..betaturn..|| |    |  || | *****|    | |  |  | | ****|            ****  |  |       
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |      ..   | |                                   | |        |  | |  |                            | | |     | | |  | |         |  |               |   |            ..gammaturn..|***    |  || |   |  |    ***  |  | |  |  |                  |  |       
search RasMol script viewer Motif-ligand binding stats  nest .. ***      ..   | |                                   | |        |  | |  |                            | | |     | | |  ***         |  |               |   |            ..nest..|  |    |  |***   |  |         |  | |  |  |                  |  |       
search RasMol script viewer Motif-ligand binding stats  niche .. ***      ..   ***                                   ***        **** ****                            *****     | | |              ****               |   |            ..niche..****    ****      ****         ******  ****                  ****       
search RasMol script viewer Motif-ligand binding stats  stmotif ..          ..   | |                                                                                     | |     *****                                 |   |            ..stmotif..                                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..          ..   | |                                                                                     | |     | |                                   *****            ..ststaple..                                                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..          ..   ***                                                                                     ***     ***                                                    ..stturn..                                                                        

   New search    1g88:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors