triangle PDBeMotif: 1g3b  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.4
Classification hydrolase    | release date: Mon, Oct 23, 2000
Title bovine beta-trypsin bound to meta-amidino schiff base magnesium(ii) chelate
Authors E.TOYOTA, H.SEKIZAKI, K.ITOH, K.K.S.NG, K.TANIZAWA, M.N.G.JAMES
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search 108 108 binding statistics 108   search SO4 SO4 binding statistics SO4   search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
DDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPS
YNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQ
ITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BETA-TRYPSIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24264PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00760
JMol viewer RasMol script viewer  108 601A  ..                                                                                                                                                                          ****  *             * ** *       *                   
JMol viewer RasMol script viewer  SO4 701A  ..                                                                                                                                                        **                ||||  |             | || |       |                   
JMol viewer RasMol script viewer  CA 502A  ..                                                   * *  *    *                                                                                          ||                ||||  |             | || |       |                   
JMol viewer RasMol script viewer  MG 501A  ..                                                   | |  |    |                                                                                          ||                ||||  |             | || |       |                   
sec str:  ......ee........eeeee...eeeeeeeee..eeeehhhhh....eeee............eeeeeeeeee.............eeeee........................eeeeee...............eeeeee..hhhhhhhhh.......eeee................eeee..eeeeeeee..........eeeee...hhhhhhhhhhh.
sequence :  ..IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
seq num:  ..16        26        38        48        58        69        79        89        99        109       119       130       141       151       161       171       181       189       199       213       223       233          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |    | | |  |           |   |||| || |||||  |       |  |               |  || ||||              | ||                   | |    |  | |||         |  ^**  | |||| ||       | |||||||| |  | ^**       | |  |         |  |     |   | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    | | |  |           |   |||| || |||||  |       |  |               |  || ||||              | ||                   | |    |  ^***|         |   |   | |||| ||       | |||||||| |  |           | |  |         |  |     |   | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** | |  |           ^*****|| || |||||  |       |  |               |  || ||||              | ||                   | ^*****    | |         |   |   | ^*****|       ^*****|||| |  |           ^*****         |  |     |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..         | |  |               | || ****^*||  |       |  |               |  || ||||              | ||                   | |         | |         |   |   | |||| ||         |||||||| |  |             |  |         |  |     |   | 
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..         | |  |               | ||  | |  ||  |       |  |               |  || ||||              | ||                   | |         | |         |   |   | |||| ||         |******^*****             |  |         |  |     |   | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |  |               ***|  | |  ||  |       |  |               |  |***|||              ***|                   | |         | |         |   |   | |||| ||         |||||||| |                |  |         |  |     |   | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |  |               |  |  | |  ||  |       |  |               |  |   |||              |  |                   | |         | |         |   |   ****|| ||         |||*******                |  |         ****     |   | 
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |               |  |  | |  ||  |       |  |               |  |   ***              |  |                   | |         | |         |   |     ***| ||         |||||*** |                |  |                  |   | 
search RasMol script viewer Motif-ligand binding stats  niche ..           ****               ****  | ********       ****               ****   |||              ****                   ***         ***         |   |     *******         |||||*****                ****                  |   | 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                    |                                          |||                                                             *****        | |          ||||||                                          |   | 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                    |                                          |||                                                                          | |          ||||||                                          ***** 
search RasMol script viewer Motif-ligand binding stats  stturn ..                                    |                                          ***                                                                          ***          ||||||                                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                    *                                           *                                                                                        ******                                                

   New search    1g3b:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors