triangle PDBeMotif: 1g1e  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription    | release date: Wed, Oct 11, 2000
Title nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain
Authors I.RADHAKRISHNAN, K.BRUBAKER, K.HUANG, R.N.EISENMAN, S.M.COWLEY
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
RMNIQMLLEAADYLER
Chain B sequence:
SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLS
EFGQFLPDA
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  *****|******  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ***********   

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  | |  || || ||  |      | || ||| ||  ||| |||      ^***  |  |             |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  | ***** || ||  |      | || ||| |*****| |||      | ||  |  |             |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **** **************      *******************|      | |*******             |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..                                   |   |       |  ***      | |                    |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                   |   |       |    |      | |                    ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                   |   |       ******      | |                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                   *****                   | |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |   *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****   ****   

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  |           |  |   |  |||| ||   |  | | ||| |    ^***  |  ||                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  |           |  |   *****|| ||   |  | | ||| |    | |   *****                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****           ****   **********   **** ****| |    | |   ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  *** |    | |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    ***    | |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       ||*****| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ******** 

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |              |  |||  |      | || |||         | | |    ^***| ||||| |  |              
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |              *****|  |      | |*****         | | |    *********** |  |              
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |              **** ****      *******          | | |    **********  ****              
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***                                              | | |    | | |                         
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  *** |    | | |                         
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    ***    | | |                         
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                           *****                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      *****     
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****      

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                   |  ||  |  |  |  |  ||   |  ||           ^***  |  |            |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                   |  ||  |  |  |  *****   *****           | |   |  |            |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ********  ****  ****    ****            | |   ****            ****    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         *******
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****** 

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  ||           |  |   |  |  |  ||         | | |    ^***  |  |           | || || |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       *****           |  |   |  |  *****         | | |    | |   |  |           | || || |
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****            ****   ****  ****          | | |    | |   ****           **** || |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                  | | |    | |                    |  |***
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  *** |    | |                    |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                    ***    | |                    ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |     *****  
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |     ****   
search RasMol script viewer Motif-ligand binding stats  nest .. ***            

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |                   |  |      | |||||   |  || || |      ^***| || ||                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |                   |  |      *****||   |  ***** |      | | | *****                   
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |                   ****      *******   ******** |      | | ******                    
search RasMol script viewer Motif-ligand binding stats  nest .. ***                                              ***      | |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        ******  
search RasMol script viewer Motif-ligand binding stats  betaturn ..        *****   

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  |  |  |     |  |  || || || ||||  |     | |      ^***  |     |  |      |  |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  |  |  |     |  |  || || |*****|  |     | |         |  |     |  |      |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..        ****  ****     ****  *********** ****     | |         ****     ****      ****    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  ***                                    

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****   

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |                  |  |      | || |||                  ^***  |  ||           || ||| |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |                  |  |      | |*****                  | ||  *****           || ||| |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |                  ****      *******                   | |*******            ****|| |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***                                                      | |                    |  |***
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           | |                    ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   *****   |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****    **** 

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             |  || || ||  |         |  |        | |||      ^***  | || ||    || || |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             ***** || ||  |         |  |        | |||      | |   | *****    || || |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****  ********         ****        ****|      | |   ******     ***** |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  ***      | |                    |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                           | |                    ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         ***** |
search RasMol script viewer Motif-ligand binding stats  betaturn ..         *******

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       |  |   |  ||  |||  |  |  || || ||     | ||||||      ^***| || ||           || ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |  |   *********|  |  ***** || ||     *******|          | *****           || ||   
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****   ******** ****  ***********     ****** |          ******            ****|   
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  ***                             |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                                                  ****   

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | *****| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ******** 

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  | |  || |  ||  |  || |||||||||  |  ||  ||| |    ^***| || ||                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        |  | ***** *****  |  |***********  |  |*****| |    | ||| *****                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **** ****  ********  ***********   ******** | |    | |*******                    
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  *****    | |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | *******
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ******** 

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |        | ||||    |  |      | |||||  ||| ||||| |   | |^***| || ||         |  |      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |        *****|    |  |      *****||  ||******* |   | || | | *****         |  |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |        ******    ****      ****************** |   | || | ******          ****      
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                                             ***   | || |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ***| |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         *****  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ****   

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |    |  | |  |||  |||  |  ||  | |||||| |||  |  ||    | |^***                 |  |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |    |  | **********|  *****  *****||*****  *****    | || |                  |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |    **** **** **** *********************   ****     | || |                  ****     
search RasMol script viewer Motif-ligand binding stats  nest .. ***                                                    | || |                           
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ***| |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       || |*****
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ******** 

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |   |  |     |||||||  |  ||  |||| ||   |  ||  ||    | |^***  |  ||          | || |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |   |  |     |******  *********|| ||   |  |*****    | || |   *****          | || |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |   ****     ***********************   ********     | || |   ****           **** |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  ***                                                   | || |                    |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                                        ***| |                    ****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MAD1 PROTEIN
member of: GB:search4505069PANTHER:searchPTHR11969/searchPTHR11969_SF18UniProt:searchQ05195
sec str:  .....hhhhhhhhhhhh.
sequence :  ..RMNIQMLLEAADYLER
seq num:  ..6         16    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    **********  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    **** ****   

chain B : SIN3A
member of: CATH:search1.20.1160.11GENE3D:searchG3DSA_1.20.1160.11PANTHER:searchPTHR12346/searchPTHR12346_SF2PFAM:searchPF02671PROSITE PROFILES:searchPS51477, SUPERFAMILY:searchSSF47762UniProt:searchQ60520
sec str:  .........hhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhh....hhhhhhhh......
sequence :  ..SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
seq num:  ..295       305       315       325       335       345       355       365       375      
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       || ||   |  |  | |  |  |  || |||||   |  || ||||      ^***  |  |         || ||   | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       || ||   |  |  | |  |  *********||   *********|      | |   |  |         || ||   | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..       *****   ******* ****  ***********   ******** |      | |   ****         *****   | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                                  | |      | |                        ***
search RasMol script viewer Motif-ligand binding stats  nest ..                                                  ***      | |                           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                           ***                           

   New search    1g1e:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML