triangle PDBeMotif: 1fta  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.3.11
Classification hydrolase (phosphoric monoester)    | release date: Mon, Sep 27, 1993
Title fructose-1,6-bisphosphatase(d-fructose-1,6-bisphosphate, 1- phosphohydrolase) (e.c.3.1.3.11) complexed with the alloste inhibitor amp
Authors J.-Y.LIANG, S.HUANG, W.N.LIPSCOMB, Y.ZHANG
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search AMP AMP binding statistics AMP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
ADQAPFDTDVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAGSTNVTGDQVKKLDVLSNDL
VMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLV
AAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPY
GARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGS
PDDVLEFLKVYEKHSAQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FRUCTOSE-1,6-BISPHOSPHATASE
member of: CATH:search3.30.540.10/search3.40.190.80GENE3D:searchG3DSA_3.30.540.10/searchG3DSA_3.40.190.80HAMAP:searchMF_01855PANTHER:searchPTHR11556/searchPTHR11556_SF11PFAM:searchPF00316PIRSF:searchPIRSF000904/searchPIRSF500210PRINTS:searchF16BPHPHTASEPROSITE PATTERNS:searchPS00124, SUPERFAMILY:searchSSF56655UniProt:searchP09467
JMol viewer RasMol script viewer  AMP 338A  ..        *  **  * ******                              ..                                          **                                              *                *                                                                                                                                                              
sec str:  .....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhh...eeee.......eeee......eeeeee....hhhhh....eeeeeeee.........hhhhh......eeeeeeee...eeeeee....eeeeeee....eeeeeeee........eee..........hhhhhhhhhhhh.......eeee...hhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhhh..eee...................eeeehhhhhhhhhhhhhh..
sequence :  ..DVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAG..VKKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGSPDDVLEFLKVYEKHS
seq num:  ..9         19        29        39        49        59 ..70        80        90        100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | |||||||||||| ||||||| ||||||| |||||| ||||| ..    |  |  |||| |||||||    | ||      || ||| |      | ||| |||||  |    | |||| || | |||  || ||                           | || |                 |  | || ||| | ||||  || | |||       |||  || ||  ||        |  |  |||       | ||||  |||  ||||| |  |   | |||      |  |  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | |||||||||||| ||||||| ||||||| |||||| ||||| ..    |  |  |||| |||||||    | ||      || ||| |      | ||| |||||  |    | **^* || | |||  || ||                           | || |                 |  | || ||| | ||||  || | |||       |||  || ||  ||        |  |  |||       | ||||  |||  ||||| |  |   | |||      |  |  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | |||||||||||| ||||||| ||||||| |||||| ||||| ..    |  |  |||| |||||||    | ||      || ||| |      | ||| |||||  |    |  | | || ^**||  || ||                           | || |                 |  | || ||| | ||||  || | |||       |||  || ||  ||        |  |  |||       | ||||  |||  |^**| |  |   | |||      |  |  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | |||||||||||| ||||||| ||||||| |||||| ||||| ..    |  |  |||| |||||||    ^***      || ||| |      | ||^***|||  |    |  | ^*** ^***|  || ||                           | || |                 ^*** || ||| | ||||  || | |||       |||  || ||  ||        |  |  |||       | ||||  |||  |^*** |  |   | |||      ^***  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | |||||||||||| ||||||| ||||||| |||||| ||^***..    |  |  |||| |||||||    | ||      || ||| |      | ||| | |||  ^*****  | | |  | |||  || ||                           | || |                      || ||| | ||||  || | |||       |^***** ||  ||        |  |  |||       | ||||  |^*****|   |  |   | |||         |  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         | ^***|||||||| ||||||| ||||||| |||||| ||||| ..    |  |  |||| |||||||    | ||      || ||| |      | ||| | |||          | | |  | |||  || ||                           | || |                      || ||| | ||||  || | |||       | |  |  ||  ||        |  |  |||       | ||||  | |  | |   |  |   | |||         |  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  FBPASE ..         |  || |||||||| ||||||| ||||||| |||||| ||||| ..    |  |  |||| |||||||    | ||      || ||| |      | ||| | |||          | | |  | |||  || ||                           | || |                      || ||| | ||||  || | |||       | |  |  ||  ||        |  |  *^***********|||  | |  | |   |  |   | |||         |  ||||||| | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         ***** |||||||***************** ||||*****||| ..    |  *****|*****||||    | ||      || ||| |      | ||| | |||          | | |  | |||  || ||                           | || |                      || ||| ********** | |||       | |  *********        |  |  | |       *****|  | |  | |   |  |   | |||         ********** | 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         |  || |||||||| ||||||| ||||||| |||||| ||||| ..    |  |  | || || ||||    | ||      || ||| |      | ||| | |||          | | |  | |||  || ||                           | || |                      || ||*****| |  |  | |||       | |  |  ||  |         |  |  | |       |  | |  | |  | |   |  |   *****         |  | || |  | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..         |  || |||||||| ||||||| ||||||| |||||| ||||| ..    |  |  | || || ||||    | ||      || ||| |      | ||| | |||          | | |  | |||  || ||                           ***| |                      || ||  |  | |  |  | |||       | |  |  ||  |         |  |  | |       |  | |  | |  | |   |  |   ***|          |  | || |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ********|||||**************************|||| ..    |  **** ***** ||||    | ||      ****|| |      **********|          | | |  ****|  ****|                              | |                      ****|  **** ****  ****|       | |  ********         |  |  | |       **** **** |  | |   |  |   ****          ************ 
search RasMol script viewer Motif-ligand binding stats  nest ..               *******    |   |         ******  **** ..    |             ****    | ||       |  || |        ***   ***          | | |  | | |   |  |                              ***                       |  |               ***       ***                   |  |  | |               ***  | |   |  |   |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..                          |   |                      ..    |             | |     ****       *******                           *****  | | |   ****                                                        ****                                               ****  ***                    | |   ****   ****                       
search RasMol script viewer Motif-ligand binding stats  stmotif ..                          |   |                      ..    |             | |     | |                                                 *****                                                                                                                                               | |                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          *****                      ..    |             | |     | |                                                 | |                                                                                                                                                 | |                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                     ..    |             ***     ***                                                 ***                                                                                                                                                 ***                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                     ..    *                       *                                                                                                                                                                                                                                             

chain B : FRUCTOSE-1,6-BISPHOSPHATASE
member of: CATH:search3.30.540.10/search3.40.190.80GENE3D:searchG3DSA_3.30.540.10/searchG3DSA_3.40.190.80HAMAP:searchMF_01855PANTHER:searchPTHR11556/searchPTHR11556_SF11PFAM:searchPF00316PIRSF:searchPIRSF000904/searchPIRSF500210PRINTS:searchF16BPHPHTASEPROSITE PATTERNS:searchPS00124, SUPERFAMILY:searchSSF56655UniProt:searchP09467
JMol viewer RasMol script viewer  AMP 338B  ..        *  **  * ******                              ..                                        **                          *                   *                *                                                                                                                                                              
sec str:  .....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh...eeee.......eeee......eeeeee....hhhhh....eeeeeeee.........hhhhh......eeeeeeee...eeeeee....eeeeeee....eeeeeeee........eee..........hhhhhhhhhhhh.......eeee...hhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhhh..eee...................eeeehhhhhhhhhhhhhh..
sequence :  ..DVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAG..KLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGSPDDVLEFLKVYEKHS
seq num:  ..9         19        29        39        49        59 ..72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           | |||||||||    ||  |||  ||  |||||||  |||| .. || ||  |||| || ||||    | ||       |  |         | |||| || |  |    | |||| || | || | || ||                 |  |      | || |   ||            | ||| |  |   |  |        | |       |||  || | |              | ||||      |  || ||||||   | || |  |   |  |       |  | |  || |    
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           | |||||||||    ||  |||  ||  |||||||  |||| .. || ||  |||| || ||||    | ||       |  |         | |||| || |  |    | **^* || | || | || ||                 |  |      | || |   ||            | ||| |  |   |  |        | |       |||  || | |              | ||||      |  || ||||||   | || |  |   |  |       |  | |  || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           | |||||||||    ||  |||  ||  |||||||  |||| .. || ||  |||| || ||||    | ||       |  |         | |||| || |  |    |  | | || ^**| | || ||                 |  |      | || |   ||            | ||| |  |   |  |        | |       |||  || | |              | ||||      |  || ||||||   ^**| |  |   |  |       |  | |  || |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           | |||||||||    ||  |||  ||  |||||||  |||| .. || ||  |||| || ||||    ^***       |  |         | ||^***| |  |    |  | ^*** ^*** | || ||                 |  |      | || |   ||            ^***| |  |   |  |        | |       |||  || | |              | ||||      |  || ||||||   ^*** |  |   |  |       ^*** |  || |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           | |||||||||    ||  |||  ||  |||||||  |^***.. || ||  |||| || ||||    | ||       |  |         | ||||  | |  ^*****  | | |    |  | || ||                 |  |      | || |   ||              | | |  |   |  |        | |       |^***** | |              | ||||      |  || ||||^*****    |  |   |  |            |  || |    
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           ^***|||||||    ||  |||  ||  |||||||  |||| .. || ||  |||| || ||||    | ||       |  |         | ||||  | |          | | |    |  | || ||                 |  |      | || |   ||              | | |  |   |  |        | |       | |  || | |              | ||||      |  || |||| |        |  |   |  |            |  || |    
search RasMol script viewer Motif-ligand binding stats  FBPASE ..             | |||||||    ||  |||  ||  |||||||  |||| .. || ||  |||| || ||||    | ||       |  |         | ||||  | |          | | |    |  | || ||                 |  |      | || |   ||              | | |  |   |  |        | |       | |  || | |              | |*^***********| |||| |        |  |   |  |            |  || |    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             | |||||||    |**************|||||  |||| .. *********|| || ||||    | ||       |  |         | ||||  | |          | | |    |  | || ||                 |  |      | || |   ||              | | |  |   |  |        | |       | |  || | |              | || |      *********| |        |  |   |  |            ***** |    
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |||||||    ||  | |  ||  |||||||  |||| .. || ||  | || || ||||    | ||       |  |         | ||||  | |          | | |    |  | || ||                 |  |      ***| |   ||              *** |  |   |  |        | |       | |  || | |              | || |      |  || || | |        |  |   |  |            |  |  |    
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |||||||    ||  | |  ||  |||||||  |||| .. || ||  | || || ||||    | ||       |  |         | ||||  | |          | | |    |  | || ||                 |  |      |  | |   **                  |  |   |  |        | |       | |  || | |              | || |      |  || || | |        |  |   |  |            |  |  |    
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             | |||||||    ||  | |  ||  |||||||  |||| .. || ||  | || || ||||    | ||       |  |         | ||||  | |          | | |    |  | || ||                 |  |      ******                       |  |   |  |        | |       | |  || | |              | || |      |  || || | |        |  |   |  |            |  |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ****|||||    |**** ********|****|  |||| .. ******** *******|||    | ||       |  |         ******  | |          | | |    **** ****|                 ****         | |                       |  |   ****        | |       | |  **** |              **** |      ********** |        |  |   |  |            *******    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               | |||||    |   |         |*** |  |||| ..  |             ||||    | ||       |  |           | |   | |          | | |          |  |                              | |                       |  |               ***       | |   |   |              ***| |               | |        |  |   |  |                       
search RasMol script viewer Motif-ligand binding stats  nest ..               *******    |   |         ******  **** ..  |             ****    | ||       |  |           ***   ***          | | |          |  |                              ***                       |  |                         ***   |   |                 | |               ***        |  |   |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..                          |   |                      ..  |             | |     ****       ****                              *****          ****                                                        ****                               |   |                 ***                          ****   ****                       
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          *****                      ..  |             | |       |                                                                                                                                                        *****                                                                                
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                     ..  |             ***       |                                                                                                                                                                                                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                     ..  *                       *                                                                                                                                                                                                                                             

chain C : FRUCTOSE-1,6-BISPHOSPHATASE
member of: CATH:search3.30.540.10/search3.40.190.80GENE3D:searchG3DSA_3.30.540.10/searchG3DSA_3.40.190.80HAMAP:searchMF_01855PANTHER:searchPTHR11556/searchPTHR11556_SF11PFAM:searchPF00316PIRSF:searchPIRSF000904/searchPIRSF500210PRINTS:searchF16BPHPHTASEPROSITE PATTERNS:searchPS00124, SUPERFAMILY:searchSSF56655UniProt:searchP09467
JMol viewer RasMol script viewer  AMP 338C  ..        *  **  * ******                              ..                                        **                          *                   *                *                                                                                                                                                              
sec str:  .....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh...eeee.......eeee......eeeeee....hhhhh....eeeeeeee.........hhhhh......eeeeeeee...eeeeee....eeeeeee....eeeeeeee........eee..........hhhhhhhhhhhh.......eeee...hhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhhh..eee...................eeeehhhhhhhhhhhhhh..
sequence :  ..DVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAG..KLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGSPDDVLEFLKVYEKHS
seq num:  ..9         19        29        39        49        59 ..72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..           || || ||||||||||||||| |  |   | |||| ||||| ..  ||||||| |  || ||||    | |||      |  || |      | ||| |||||  |    | |||| || | ||    |  |                 |  |      | || |   ||            | ||||| || || ||||  || | |         |||   | |  ||         | ||  |||       | |||||||||   | || |  |              | || || ||||||| 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..           || || ||||||||||||||| |  |   | |||| ||||| ..  ||||||| |  || ||||    | |||      |  || |      | ||| |||||  |    | **^* || | ||    |  |                 |  |      | || |   ||            | ||||| || || ||||  || | |         |||   | |  ||         | ||  |||       | |||||||||   | || |  |              | || || ||||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..           || || ||||||||||||||| |  |   | |||| ||||| ..  ||||||| |  || ||||    | |||      |  || |      | ||| |||||  |    |  | | || ^**|    |  |                 |  |      | || |   ||            | ||||| || || ||||  || | |         |||   | |  ||         | ||  |||       | |||||||||   ^**| |  |              | || || ||||||| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..           || || ||||||||||||||| |  |   | |||| ||||| ..  ||||||| |  || ||||    ^***|      |  || |      | ||^***|||  |    |  | ^*** ^***    |  |                 |  |      | || |   ||            ^***||| || || ||||  || | |         |||   | |  ||         | ||  |||       | |||||||||   ^*** |  |              ^*** || ||||||| 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..           || || ||||||||||||||| |  |   | |||| ||^***..  ||||||| |  || ||||    | |||      |  || |      | ||| | |||  ^*****  | | |  | |     |  |                 |  |      | || |   ||              ||||| || || ||||  || | |         |^***** |  ||         | ||  |||       | |||||||^*****    |  |                |  || ||||||| 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           ^***| ||||||||||||||| |  |   | |||| ||||| ..  ||||||| |  || ||||    | |||      |  || |      | ||| | |||          | | |  | |     |  |                 |  |      | || |   ||              ||||| || || ||||  || | |         | |     |  ||         | ||  |||       | ||||||| |        |  |                |  || ||||||| 
search RasMol script viewer Motif-ligand binding stats  FBPASE ..            |  | ||||||||||||||| |  |   | |||| ||||| ..  ||||||| |  || ||||    | |||      |  || |      | ||| | |||          | | |  | |     |  |                 |  |      | || |   ||              ||||| || || ||||  || | |         | |     |  ||         | ||  *^***********|||||| |        |  |                |  || ||||||| 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            |  | |||||********** |  |   | ||*****||| ..  ******* ***** ||||    | |||      |  || |      | ||| | |||          | | |  | |     |  |                 |  |      | || |   ||              ||||| || |********** | |         | |     *****         | ||  | |       ********| |        |  |                ***** ******| 
search RasMol script viewer Motif-ligand binding stats  asxturn ..            |  | |||||||||||| |  |  |   | |||| ||||| ..  ||||||  |  |  ||||    | |||      |  || |      | ||| | |||          | | |  | |     |  |                 |  |      ***| |   ||              ***|| || || || |  |  | |         | |     |  |          | ||  | |       | || || | |        |  |                |  |  ||||||| 
search RasMol script viewer Motif-ligand binding stats  betabulge ..            |  | |||||||||||| |  |  |   | |||| ||||| ..  ||||||  |  |  ||||    | |||      |  || |      | ||| | |||          | | |  | |     |  |                 |  |      |  | |   **               | || || || || |  |  | |         | |     |  |          | ||  | |       | || || | |        |  |                |  |  ||||||| 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..            |  | |||||||||||| |  |  |   | |||| ||||| ..  ||||||  |  |  ||||    | |||      |  || |      | ||| | |||          | | |  | |     |  |                 |  |      ******                    | || || || || |  |  | |         | |     |  |          | ||  | |       | || || | |        |  |                |  |  ||||||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..            **** |||||*********  ****   | ||****|||| ..  ***************|||    ****|      |  || |      ****| ****|          | | |  | |     |  |                 ****         | |                    ******| ***** ****  | |         | |     ****          | |**** |       ********* |        |  |                ****  ******* 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..               | |||||    |   |         | || |  |||| ..  |             ||||    | |||      |  || |        | |   | |          | | |  | |     |  |                              | |                       |  |             ***         | |                   ***   | |               | |        |  |                              
search RasMol script viewer Motif-ligand binding stats  nest ..               *******    |   |         ******  **** ..  |             ****    | |||      |  || |        ***   ***          | | |  | |     |  |                              ***                       |  |                         ***                         | |               ***        |  |                              
search RasMol script viewer Motif-ligand binding stats  niche ..                          |   |                      ..  |             |***    ****|      *******                           *****  | |     ****                                                        ****                                                     ***                          ****                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                          |   |                      ..  |             | |     *****                                               | |                                                                                                                                                                                         
search RasMol script viewer Motif-ligand binding stats  ststaple ..                          *****                      ..  |             | |     | |                                                 | |                                                                                                                                                                                         
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                     ..  |             ***     ***                                                 ***                                                                                                                                                                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                     ..  *                       *                                                                                                                                                                                                                                             

chain D : FRUCTOSE-1,6-BISPHOSPHATASE
member of: CATH:search3.30.540.10/search3.40.190.80GENE3D:searchG3DSA_3.30.540.10/searchG3DSA_3.40.190.80HAMAP:searchMF_01855PANTHER:searchPTHR11556/searchPTHR11556_SF11PFAM:searchPF00316PIRSF:searchPIRSF000904/searchPIRSF500210PRINTS:searchF16BPHPHTASEPROSITE PATTERNS:searchPS00124, SUPERFAMILY:searchSSF56655UniProt:searchP09467
JMol viewer RasMol script viewer  AMP 338D  ..        *  **  * ******                              ..                                         **                          *                                    *                                                                                                                                                              
sec str:  .....hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhh...eeee.......eeee......eeeeee....hhhhh....eeeeeeee.........hhhhh......eeeeeeee...eeeeee....eeeeeee....eeeeeeee........eee..........hhhhhhhhhhhh.......eeee...hhhhhhhhhhhh.eeeee...........hhhhhhhhhhhhhhhh..eee...................eeeehhhhhhhhhhhhhh..
sequence :  ..DVVTLTRFVMEEGRKARGTGELTQLLNSLCTAVKAISSAVRKAGIAHLYGIAG..KKLDVLSNDLVMNMLKSSFATCVLVSEEDKHAIIVEPEKRGKYVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAAGYALYGSATMLVLAMDCGVNCFMLDPAIGEFILVDKDVKIKKKGKIYSLNEAYAKDFDPAVTEYIQRKKFPPDNSAPYGARYVGSMVADVHRTLVYGGIFLYPANKKSPNGKLRLLYECNPMAYVMEKAGGMATTGKEAVLDVIPTDIHQRAPIILGSPDDVLEFLKVYEKHS
seq num:  ..9         19        29        39        49        59 ..71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |  |||||||||||||     | |||||    | || |  |||| ..  || || |||   |  ||||    | |||      |  || |      |  ||  || |  |    | | || || | || | || ||                           ||||||   ||            | ||||| ||  |  |||| || | |||       |||   | || ||         | |   |||       | || || |||   |||| |  |   |  |       |  |  |||  || | 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..        |  |||||||||||||     | |||||    | || |  |||| ..  || || |||   |  ||||    | |||      |  || |      |  ||  || |  |    | **^* || | || | || ||                           ||||||   ||            | ||||| ||  |  |||| || | |||       |||   | || ||         | |   |||       | || || |||   |||| |  |   |  |       |  |  |||  || | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |  |||||||||||||     | |||||    | || |  |||| ..  || || |||   |  ||||    | |||      |  || |      |  ||  || |  |    |    | || ^**| | || ||                           ||||||   ||            | ||||| ||  |  |||| || | |||       |||   | || ||         | |   |||       | || || |||   ^**| |  |   |  |       |  |  |||  || | 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |  |||||||||||||     | |||||    | || |  |||| ..  || || |||   |  ||||    ^***|      |  || |      |  |^***| |  |    |    ^*** ^*** | || ||                           ||||||   ||            ^***||| ||  |  |||| || | |||       |||   | || ||         | |   |||       | || || |||   ^*** |  |   |  |       ^***  |||  || | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        |  |||||||||||||     | |||||    | || |  |^***..  || || |||   |  ||||    | |||      |  || |      |  |    | |  ^*****    | |    |  | || ||                           ||||||   ||              | ||| ||  |  |||| || | |||       |^***** || ||         | |   |||       | || || |^*****||| |  |   |  |          |  |||  || | 
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..        |  ^***|||||||||     | |||||    | || |  |||| ..  || || |||   |  ||||    | |||      |  || |      |  |    | |            | |    |  | || ||                           ||||||   ||              | ||| ||  |  |||| || | |||       | |     || ||         | |   |||       | || || |||   |||| |  |   |  |          |  |||  || | 
search RasMol script viewer Motif-ligand binding stats  FBPASE ..        |  ||| |||||||||     | |||||    | || |  |||| ..  || || |||   |  ||||    | |||      |  || |      |  |    | |            | |    |  | || ||                           ||||||   ||              | ||| ||  |  |||| || | |||       | |     || ||         | |   *^***********| || |||   |||| |  |   |  |          |  |||  || | 
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..        *****| ||||*****     *******    | || |  |||| ..  *********   |  ||||    | |||      |  || |      |  |    | |            | |    |  | || ||                           ||||||   ||              | |*****  ********** | |||       | |     *****         | |   | |       |  | || |||   |||| |  |   |  |          ********** | 
search RasMol script viewer Motif-ligand binding stats  asxturn ..        |  | | ||||||||      | || |     | || |  |||| ..  || || ||    |  ||||    | |||      |  || |      |  |    | |            | |    |  | || ||                           ***|||   ||              ***|| ||  |  | || || | |||       | |     || ||         ***   | |       |  | || |||   |||| |  |   |  |          |  | |  |  | 
search RasMol script viewer Motif-ligand binding stats  betabulge ..        |  | | ||||||||      | || |     | || |  |||| ..  || || ||    |  ||||    | |||      |  || |      |  |    | |            | |    |  | || ||                           || |||   **                 || ||  |  | || || | |||       | |     || ||               | |       |  | || |||   |||| |  |   |  |          |  | |  |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..        **** ****||****      ******     | || |  |||| ..  ********    ****|||    ****|      |  || |      ****    | |            | |    **** *****                           |****|                      *****  **** ***** ****|       | |     *****               | |       **** *****|   |||| |  |   |  |          **** ******* 
search RasMol script viewer Motif-ligand binding stats  nest ..               *******                  ******  **** ..   |             ****    | |||      |  || |              ***            | |          |  |                           |  ***                       |  |               ***       ***                         | |            |  ***   **** |  |   |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..                                                     ..   |             | |     ****|      *******                             ***          ****                           |    |                       ****                                                     ***            |    |   | |  ****   ****                       
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                     ..   |             | |     | | |                                                                                      ******                                                                                               ******   | |                                    
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                     ..   |             | |     *****                                                                                                                                                                                                    | |                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                     ..   |             ***     ***                                                                                                                                                                                                      ***                                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                     ..   *                       *                                                                                                                                                                                                                                             

   New search    1fta:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML