triangle PDBeMotif: 1ffj  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification toxin    | release date: Tue, Jul 25, 2000
Title nmr structure of cardiotoxin in dpc-micelle
Authors A.S.ARSENIEV, D.V.DEMENTIEVA, E.V.BOCHAROV, P.V.DUBOVSKII, Y.N.UTKIN
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^** |
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***| |
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                      | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                                 || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..                                 || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..                                 **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..                                                       ****|
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |     |  |               || ||   |          || ^** |
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |     |  |               || *^***^**********^^***| |
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |     |  |               **                      | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |     ****                                       | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***     |  |                                       | |
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |                                       ***
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                                          

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |     |  |                  ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |     |  |                  *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |     ****                                     ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***     |  |                                       | |
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |                                       ***
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                                          

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..              |  |                  ||| ||          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..              |  |                  *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..              ****                    | |              ****|
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |                    | |                ***
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                    ***                   

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |     |  |               || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |     |  |               || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |     |  |               **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |     ****                                     ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***     |  |                                       | |
search RasMol script viewer Motif-ligand binding stats  nest ..              |  |                                       ***
search RasMol script viewer Motif-ligand binding stats  niche ..              ****                                          

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                           ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                           *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CYTOTOXIN 2
member of: CATH:search2.10.60.10GENE3D:searchG3DSA_2.10.60.10PFAM:searchPF00087PRINTS:searchCYTOTOXINPROSITE PATTERNS:searchPS00272, SUPERFAMILY:searchSSF57302UniProt:searchP01441
sec str:  ...eee......eee......eeeeeee......eeeeeee.........eeeeee......
sequence :  ..LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
seq num:  ..1         11        21        31        41        51        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                        || ||   |          || ^**||
search RasMol script viewer Motif-ligand binding stats  SNAKE_TOXIN ..      | |                        || *^***^**********^^***|||
search RasMol script viewer Motif-ligand binding stats  betabulge ..      | |                        **                    | |||
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |                                              ****|
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***                                                | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                                         ***

   New search    1ffj:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML