triangle PDBeMotif: 1f15  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification virus    | release date: Thu, May 18, 2000
Title cucumber mosaic virus (strain fny)
Authors E.CHASE, K.PERRY, T.J.SMITH, T.SCHMIDT
Method X-RAY DIFFRACTION (resolution: 3.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
MDKSESTSAGRNRRRRPRRGSRSAPSSADANFRVLSQQLSRLNKTLAAGRPTINHPTFVGSERCRPGYTFTSITLKPPKI
DRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGV
QANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : COAT PROTEIN
member of: CATH:search2.60.120.530GENE3D:searchG3DSA_2.60.120.530PFAM:searchPF00760PRINTS:searchCUCUMOCOATSUPERFAMILY:searchSSF88633UniProt:searchP69466
sec str:  ........ee..eeee.........eeeee...hhhhhh....eeeeeeeeeee.......eeeeeee..........hhhhhhhh.....eee................hhhhheehhhhh.eeeeee..........eeeeeeeeee..........
sequence :  ..ERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
seq num:  ..62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. | |  |     | |    | || | ||   | |||||  |           |  |      | |     | |          ||||      | | | |  |    ||| | |   || ||     |  | |  | |                   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. | |  |     | |    | || | ||   | |||||  |           |  |      | |     | |          ||||      | | | |  |    ||| | |   || ||     |  | |  | |                   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..** |  |     ^**    | || | ||   | |||||  |           |  |      ^**     | |          ||||      | | | |  |    ||| | |   || ||     |  | |  | |                   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  |            | || | ||   | ^***|  |           |  |              | |          ||||      | | | |  |    ||| | |   || ||     ^*** |  | |                   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..****  |            | ^*****|   |  || |  |           |  |              | |          ||||      | | ^*****    ||| | |   || ||        | |  | |                   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   |  |            |  | ^***   |  || |  |           |  |              | |          ||||      | | | |       ||| | |   || ||        | |  | |                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  |            |  |        ***** |  |           |  |              | |          ||||      | | | |       ||| | |   || ||        | |  | |                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |            |  |        |  |  |  |           |  |              | |          ***|      | | | |       *** | |   || ||        | |  | |                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ****            ****        ****  ****           ****              | |          ||||      | | | |        **** |   ****|        | |  | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |                              |  |           |  |              ***          ****      *** ***           ***    |  |        ***  ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..   ****                              ****           ****                                                              ****                                   

chain B : COAT PROTEIN
member of: CATH:search2.60.120.530GENE3D:searchG3DSA_2.60.120.530PFAM:searchPF00760PRINTS:searchCUCUMOCOATSUPERFAMILY:searchSSF88633UniProt:searchP69466
sec str:  ....hhhhhhhhhhhhhhhhhh...................eeeeeeee.........eeeee...hhhhhh....eeeeeeeeee.......eeeeeeee........hhhhhhhhhh.....eeee..........eeeee.hhhhee.hhhh.eeeeeee..........eeeeeeeee..........
sequence :  ..DANFRVLSQQLSRLNKTLAAGRPTINHPTFVGSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
seq num:  ..29        39        49        59        69        79        89        99        109       119       129       139       149       159       169       179       189       199       209       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| | ||  ||    ^***|  | |  |  | || | |  |     | |      |  | ||   | |||||  |           |  |      | |  | |||     |  |  ||||          |    |    | | | |  ||||||     |  || |                       
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| | ||  ||        |  | |  |  | || | |  |     | |      |  | ||   | |||||  |           |  |      | |  | |||     |  |  ||||          |    |    | | | |  ||||||     |  || |                       
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| | ||  ||        |  | |  |  | |^** |  |     ^**      |  | ||   | |||||  |           |  |      ^**  | |||     |  |  ||||          |    |    | | | |  ||||||     |  || |                       
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..* | ||  ||        |  | |  |  | |    |  |              |  | ||   | ^***|  |           |  |           | |||     |  |  ||||          |    |    | | | |  ||||||     ^***| |                       
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | ||  ||        |  | |  |  | ^*****  |              ^*****|   |  || |  |           |  |           | |||     |  |  ||||          ^*****    | | | |  ||||||         | |                       
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  | ||  ||        |  | |  |  |      |  |                 ^***   |  || |  |           |  |           | |||     |  |  ||||                    | | | |  ||||||         | |                       
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |*****        |  | |  |  |      |  |                        ***** |  |           |  |           | |||     |  |  ||||                    | | | |  ||||||         | |                       
search RasMol script viewer Motif-ligand binding stats  asxturn ..  | ||  |         |  | |  |  |      |  |                        |  |  |  |           |  |           | |||     |  |  ||||                    *** | |  ||||||         | |                       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  *******         **** ****  |      ****                        **********           |  |           ****|     ****  ||||                        | |  *****|         | |                       
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |             |  |    |  |      |  |                              |  |           |  |             | |           ||||                        | |    |  |         ***                       
search RasMol script viewer Motif-ligand binding stats  nest ..  ***             |  |    |  |      |  |                              |  |           |  |             ***           ****                        ***    |  |                                   
search RasMol script viewer Motif-ligand binding stats  niche ..                  ****    ****      ****                              ****           ****             | |                                              ****                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                      ***                                                                                     

chain C : COAT PROTEIN
member of: CATH:search2.60.120.530GENE3D:searchG3DSA_2.60.120.530PFAM:searchPF00760PRINTS:searchCUCUMOCOATSUPERFAMILY:searchSSF88633UniProt:searchP69466
sec str:  ....hhhhhhhhhhhhhhhhhhh...................eeeeeeee...........eee...hhhhhh.......eeeeeeee......eeeeeeee.........hhhhhhh.......eeee..........eeeee.hhhh...hhhh.eeeeeee.........eeeeeeeeee..........
sequence :  ..ADANFRVLSQQLSRLNKTLAAGRPTINHPTFVGSERCRPGYTFTSITLKPPKIDRGSYYGKRLLLPDSVTEYDKKLVSRLQIRVNPLPKFDSTVWVTVRKVPASSDLSVAAISAMFADGASPVLVYQYAASGVQANNKLLYDLSAMRADIGDMRKYAVLVYSKDDALETDELVLHVDIEHQRIPTSGVLPV
seq num:  ..28        38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208        
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |   |    | ^***         | | || | |  |     | |      |  | ||   | || ||  |           || |      | |    | |  |  ||||||||||          | | ||    ||| |     || ||     |  |                          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |   |    |   |          | | || | |  |     | |      |  | ||   | || ||  |           || |      | |    | |  |  ||||||||||          | | ||    ||| |     || ||     |  |                          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |   |    |   |          | | |^** |  |     ^**      |  | ||   | || ||  |           || |      ^**    | |  |  ||||||||||          | | ||    ||| |     || ||     |  |                          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..**  |   |    |   |          | | |    |  |              |  | ||   | ^***|  |           || |             | |  |  ||||||||||          | | ||    ||| |     || ||     ^***                          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    |   |    |   |          | | ^*****  |              ^*****|   |  |  |  |           || |             | |  |  ||||||||||          ^*****    ||| |     || ||                                   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    |   |    |   |          | |      |  |                 ^***   |  |  |  |           || |             | |  |  ||||||||||            | |     ||| |     || ||                                   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    |   |    |   |          | |      |  |                        |  |  |  |           || |             | |  |  ||*****|||            | |     ||| |     || ||                                   
search RasMol script viewer Motif-ligand binding stats  asxturn ..    |   |    |   |          | |      |  |                        |  |  |  |           || |             | |  |  ||||||||||            | |     *** |     || ||                                   
search RasMol script viewer Motif-ligand binding stats  betaturn ..    |   |    |   |          | |      ****                        **********           ****             | |  *********||||            | |      ****     *****                                   
search RasMol script viewer Motif-ligand binding stats  nest ..    |   |    |   |          | |      |  |                              |  |            | |             ***           ****            | |                |  |                                   
search RasMol script viewer Motif-ligand binding stats  niche ..    |   |    |   |          ***      ****                              ****            ***                                           ***                ****                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..    *****    *****                                                                                                                                                                             

   New search    1f15:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML