triangle PDBeMotif: 1ezf  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.5.1.21
Classification transferase    | release date: Wed, May 10, 2000
Title crystal structure of human squalene synthase
Authors C.M.HAYWARD, D.E.DANLEY, E.S.HAMANAKA, G.K.SCHULTE, H.J.HARWOOD, J.F.THOMPSON, J.PANDIT, S.M.MAZZALUPO, T.A.PAULY
Method X-RAY DIFFRACTION (resolution: 2.15Å)
PDBe Citation   
Small molecules:    search IN0 IN0 binding statistics IN0
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C sequence:
MDRNSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWR
FMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSAS
EFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHI
PDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKIRKGQAVTLMMDATNMPAVKAIIYQYMEEIYHRIP
DSDPSSSKTRQIISTIRTQN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
member of: CATH:search1.10.600.10GENE3D:searchG3DSA_1.10.600.10PANTHER:searchPTHR11626PFAM:searchPF00494PROSITE PATTERNS:searchPS01044/searchPS01045, SUPERFAMILY:searchSSF48576TIGRFAMS:searchTIGR01559UniProt:searchP37268
JMol viewer RasMol script viewer  IN0 991A  ..              ***                 **  *                                                                                                   *   *  *                        *  **                                                                           **  *                        ..IN0 ..                                            
sec str:  ..hhhhhhhhhhhhhh.hhhhhhhh...hhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh........ .....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhh..
sequence :  ..NSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAVKI... ..DATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
seq num:  ..38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308      ... ..327       337       347       357       367 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||     ^***|     |  ||  |               || ||  ||   |      | |||||  | |  |    |  || |   |  |  ||  ||          |    ||  |   |  ||  |        |   ||| | ||||  |  ||| |   |               || |||   || ||| || |  |  |                            |  | ^***|        |   | | || |          ..PS00001..| |                |  ||  | || ||    || ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|^**|     | ^**     |  ||  |               || ||  ||   |      | |||||  | |  |    |  || |   |  |  ||  ||          |    ||  |   |  ||  |        |   ||| | ||||  |  ||^**   |               || |||   || ||| || |  |  |                            |  | |   |        |   | | || |          ..PS00005..| |                |  ||  | |^**|    |^**|  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |     |  |      |  ||  |               ^***|  ||   |      | |||||  | |  |    |  || |   |  |  ||  ||          |    ||  |   ^***|  |        |   ||| ^***||  |  ||      |               || |||   || ||| || |  |  |                            |  | |   |        |   | | || |          ..PS00006..| |                |  ||  | ||  |    |   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|   |     |  |      |  ||  |                |  |  ||   |      | |||||  | |  |    |  || |   |  |  ||  ||          ^*****|  |   |   |  |        ^*****| | ||||  |  ||      |               || |||   || ||| || |  |  |                            |  | |   |        |   | | || |          ..PS00008..| |                |  ||  | ||  |    |   |  
search RasMol script viewer Motif-ligand binding stats  SQUALEN_PHYTOEN_SYN_1 ..|   |     |  |      |  ||  |                |  |  ||   |      | |||||  | |  |    |  || |   |  |  ||  ||                |  |   |   |  **************** | ||||  |  ||      |               || |||   || ||| || |  |  |                            |  | |   |        |   | | || |          ..PS01044..| |                |  ||  | ||  |    |   |  
search RasMol script viewer Motif-ligand binding stats  SQUALEN_PHYTOEN_SYN_2 ..|   |     |  |      |  ||  |                |  |  ||   |      | |||||  | |  |    |  || |   |  |  ||  ||                |  |   |   |           |   |   | ||||  |  ||      **************************| ||| || |  |  |                            |  | |   |        |   | | || |          ..PS01045..| |                |  ||  | ||  |    |   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|   |     |  |      |  ||  |                |  |  ||   |      *****||  | |  |    ***** |   |  |  |*****                |  |   |   |           |   |   | ||||  *****                      || |||   ********* |  |  |                            |  | |   |        |   | | || |          ..alphabetamotif..| |                |  ||  | ||  |    |   |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|   |     |  |      |  ||  |                |  |  ||   |      | || ||  | |  |    |  |  |   |  |  ||  |                 |  |   |   |           |   |   | ||||  |  |                       || |||   || ||| || |  |  |                            |  | *****        |   | | || |          ..asxmotif..| |                |  ||  | ||  |    |   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |     |  |      |  |****                ****  ||   |      *******  | |  |    ****  |   |  |  |****                 |  |   |   |           |   |   | ||||  ****                       |****|   ********| ****  |                            |  | |            |   | | ****          ..betaturn..| |                ***********  |    |   |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|   |     |  |      |  |                    |  |  ||   |         |  |  | |  |          |   |  |  |                     |  |   |   |           |   |   | ||||                             |  | |    |   |  |    |  |                            |  | |            |   | | || |          ..gammaturn..***                |  ||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..|   |     |  |      |  |                    |  |  ||   |         |  |  | |  |          |   |  |  |                     |  |   |   |           |   |   | ****                             |  ***    |   |  |    |  |                            |  | |            |   | | || |          ..nest..                   |  ||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..|   |     ****      ****                    *******|   |         ******* ****          |   |  ****                     ****   |   |           |   |   | | |                              |    |    |   ****    ****                            ******            |   | ******          ..niche..                   ******** |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..|   |                                              |   |                               |   |                                  |   |           |   |   | | |                              ******    |   |                                                         |   |                 ..schellmannloop..                            |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  stmotif ..|   |                                              *****                               |   |                                  *****           |   |   | | |                                        |   |                                                         |   |                 ..stmotif..                            |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..*****                                                                                  *****                                                  ********* | |                                        *****                                                         *****                 ..ststaple..                            *****    *****  
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                                                                                        ***                                                                                                                            ..stturn..                                            

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
member of: CATH:search1.10.600.10GENE3D:searchG3DSA_1.10.600.10PANTHER:searchPTHR11626PFAM:searchPF00494PROSITE PATTERNS:searchPS01044/searchPS01045, SUPERFAMILY:searchSSF48576TIGRFAMS:searchTIGR01559UniProt:searchP37268
JMol viewer RasMol script viewer  IN0 992B  ..                 ****                  *  *                                                                                                      **  *                       **  **                                                                           *   *                      ..IN0 ..                                           
sec str:  .....hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...... ....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.
sequence :  ..NSLSNSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAV... ..ATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
seq num:  ..34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304        ... ..328       338       348       358          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     | |    | ^***|    || |||  |               || || |||  ||     |  ||  |  | |  | |  |  ||        |  |               |    ||  |   |  |   |        |   ||| | ||||| |    | |   |                | |||| ||    |  |   |||||         |  ||   || ||      |  | ^***|              | || | |  ||  ..PS00001..                 || |||  | || ||    || ||  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     ^**    | | ^**    || |||  |               || || |||  ||     |  ||  |  | |  | |  |  ||        |  |               |    ||  |   |  |   |        |   ||| | ||||| |    ^**   |                | |||| ||    |  |   |||||         |  ||   || ||      |  | |   |              | || | |  ||  ..PS00005..                 || |||  | |^**|    |^**|  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..            | | ||     || |||  |               ^***| |||  ||     |  ||  |  | |  | |  |  ||        |  |               |    ||  |   ^***   |        |   ||| ^***||| |          |                | |||| ||    |  |   |||||         |  ||   || ||      |  | |   |              | || | |  ||  ..PS00006..                 || |||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..            | | ||     || |||  |                |  | |||  ||     |  ||  |  | |  | |  |  ||        |  |               ^*****|  |          |        ^*****| | ||||| |          |                | |||| ||    |  |   |||||         |  ||   || ||      |  | |   |              | || | |  ||  ..PS00008..                 || |||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  SQUALEN_PHYTOEN_SYN_1 ..            | | ||     || |||  |                |  | |||  ||     |  ||  |  | |  | |  |  ||        |  |                     |  |          **************** | ||||| |          |                | |||| ||    |  |   |||||         |  ||   || ||      |  | |   |              | || | |  ||  ..PS01044..                 || |||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  SQUALEN_PHYTOEN_SYN_2 ..            | | ||     || |||  |                |  | |||  ||     |  ||  |  | |  | |  |  ||        |  |                     |  |                   |   |   | ||||| |          **************************    |  |   |||||         |  ||   || ||      |  | |   |              | || | |  ||  ..PS01045..                 || |||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..            | | ||     || |||  |                |  | ||*****     *****  |  | |  | |  *****        |  |                     |  |                   |   |   | ||||| |                           | |||| |     |  |   |||||         *****   || ||      |  | |   |              | || | *****  ..alphabetamotif..                 *****|  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..            | | ||     || |||  |                |  | |||  |      |  ||  |  | |  | |  |  |         |  |                     |  |                   |   |   | ||||| |                           | |||| |     |  |   |||||         |  |    || ||      |  | *****              | || | |  |   ..asxmotif..                 || |||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..            | | ||     || |||  |                |  ***||  |      |  ||  |  | |  | |  |  |         |  |                     |  |                   |   |   | ||||***                           | |||| |     |  |   |||||         |  |    || ||      |  | |                  | || | |  |   ..asxturn..                 || |||  ***   |    |   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..            | | ||     *********                |  |  |****      ********  | |  | |  ****         |  |                     ****                   |   |   ****||                              ****|| |     |  |   ****|         ****    *****      |  | |                  | **** ****   ..betaturn..                 ****||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..            | | ||      |  |                    |  |  |              |  |  | |  | |               |  |                     |  |                   |   |     ****                                ***| |     |  |   *** |                            |  | |                  |  |          ..nest..                  |  ||  | |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..            | ****      ****                    *******              ******* ******               ****                     ****                   |   |                                            ***     ****    ****                            ******                  ****          ..niche..                  ******** |   |    |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..            *****                                                                                                                                 *****                                                                                                                                  ..ststaple..                           *****    *****  

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain C : FARNESYL-DIPHOSPHATE FARNESYLTRANSFERASE
member of: CATH:search1.10.600.10GENE3D:searchG3DSA_1.10.600.10PANTHER:searchPTHR11626PFAM:searchPF00494PROSITE PATTERNS:searchPS01044/searchPS01045, SUPERFAMILY:searchSSF48576TIGRFAMS:searchTIGR01559UniProt:searchP37268
JMol viewer RasMol script viewer  IN0 995C  ..              ***                  *  *                                                                                                      **  *                       **  **                                                                           **                         ..IN0 ..                                           
sec str:  ..hhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.....hhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhh.hhhhhh...... ....hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhh.
sequence :  ..NSLKTCYKYLNQTSRSFAAVIQALDGEMRNAVCIFYLVLRALDTLEDDMTISVEKKVPLLHNFHSFLYQPDWRFMESKEKDRQVLEDFPTISLEFRNLAEKYQTVIADICRRMGIGMAEFLDKHVTSEQEWDKYCHYVAGLVGIGLSRLFSASEFEDPLVGEDTERANSMGLFLQKTNIIRDYLEDQQGGREFWPQEVWSRYVKKLGDFAKPENIDLAVQCLNELITNALHHIPDVITYLSRLRNQSVFNFCAIPQVMAIATLAACYNNQQVFKGAV... ..ATNMPAVKAIIYQYMEEIYHRIPDSDPSSSKTRQIISTIRTQN
seq num:  ..38        48        58        68        78        88        98        108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308    ... ..328       338       348       358          
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|| ||   | ^***|     |  ||  |           |   |  ||  |          |  || ||  | |  | |        |  || || ||               |   |||| |   || ||  |    |  ||    || | ||||      ||||   |                  | || |||  || ||   || ||           |   |            |  | ^***|        |   | | || | |  ||  ..PS00001..                 || ||     || ||     | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|^**|   | | ^**     |  ||  |           |   |  ||  |          |  || ||  | |  | |        |  || || ||               |   |||| |   || ||  |    |  ||    || | ||||      |^**   |                  | || |||  || ||   || ||           |   |            |  | |   |        |   | | || | |  ||  ..PS00005..                 || ||     |^**|     ^**   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|   |   | | ||      |  ||  |           |   ^***|  |          |  || ||  | |  | |        |  || || ||               |   |||| |   ^***|  |    |  ||    || ^***||      | |    |                  | || |||  || ||   || ||           |   |            |  | |   |        |   | | || | |  ||  ..PS00006..                 || ||     |   |           
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|   |   | | ||      |  ||  |           |   |   |  |          |  || ||  | |  | |        |  || || ||               ^*****|| |   ||  |  |    |  |^*****|   ||||      | |    |                  | || |||  || ||   || ||           |   |            |  | |   |        |   | | || | |  ||  ..PS00008..                 || ||     |   |           
search RasMol script viewer Motif-ligand binding stats  SQUALEN_PHYTOEN_SYN_1 ..|   |   | | ||      |  ||  |           |   |   |  |          |  || ||  | |  | |        |  || || ||                   | || |   ||  |  ****************   ||||      | |    |                  | || |||  || ||   || ||           |   |            |  | |   |        |   | | || | |  ||  ..PS01044..                 || ||     |   |           
search RasMol script viewer Motif-ligand binding stats  SQUALEN_PHYTOEN_SYN_2 ..|   |   | | ||      |  ||  |           |   |   |  |          |  || ||  | |  | |        |  || || ||                   | || |   ||  |       |  ||         ||||      | |    **************************|  || ||   || ||           |   |            |  | |   |        |   | | || | |  ||  ..PS01045..                 || ||     |   |           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|   |   | | ||      |  ||  |           |   |   |  |          |  || ||  | |  | |        ***** || ||                   | || |   ||  |       *****         ||||      | |                       | || | |  *****   || ||           |   |            |  | |   |        |   | | || | *****  ..alphabetamotif..                 *****     |   |           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|   |   | | ||      |  ||  |           |   |   |  |          |  || ||  | |  | |        |  |  || ||                   | || |   ||  |       |  |          ||||      | |                       | || | |  || ||   || ||           |   |            |  | *****        |   | | || | |  |   ..asxmotif..                 || ||     |   |           
search RasMol script viewer Motif-ligand binding stats  asxturn ..|   |   | | ||      |  ||  |           |   |   |  |          |  || ||  | |  | |        |  |  || ||                   | || |   ||  |       |  |          ||||      ***                       | || | |  || ||   || ||           |   |            |  | |            |   | | || | |  |   ..asxturn..                 || ||     |   |           
search RasMol script viewer Motif-ligand binding stats  betaturn ..|   |   | | ||      |  |****           |   |   |  |          ********  | |  | |        ****  ****|                   **** |   |****       ****          ||||                                | || | |  ****|   *****           |   |            |  | |            |   | | **** ****   ..betaturn..                 ****|     |   |           
search RasMol script viewer Motif-ligand binding stats  nest ..|   |   | | ||      |  |               |   |   |  |              |  |  | |  | |               |  |                     |  |   |   |                     ****                                ***| | |   |  |    |  |           |   |            |  | |            |   | | || |        ..nest..                  |  |     |   |           
search RasMol script viewer Motif-ligand binding stats  niche ..|   |   | ****      ****               |   |   ****              ******* ******               ****                     ****   |   |                                                            *** |   ****    ****           |   |            ******            |   | ******        ..niche..                  ****     |   |           
search RasMol script viewer Motif-ligand binding stats  stmotif ..|   |   |   |                          |   |                                | |                                               *****                                                                |   |                      |   |                              |   |               ..stmotif..                           |   |           
search RasMol script viewer Motif-ligand binding stats  ststaple ..*****   *****                          *****                                | |                                                                                                                    *****                      *****                              *****               ..ststaple..                           *****           
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                            ***                                                                                                                                                                                                      ..stturn..                                           

   New search    1ezf:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors