triangle PDBeMotif: 1ekv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.6.1.42
Classification transferase    | release date: Thu, Mar 9, 2000
Title human branched chain amino acid aminotransferase (mitochondr three dimensional structure of enzyme inactivated by tris b the pyridoxal-5'-phosphate on one end and active site lys20 the other.
Authors G.K.FARBER, J.H.DUNBAR, M.CONWAY, N.H.YENNAWAR, S.M.HUTSON
Method X-RAY DIFFRACTION (resolution: 2.25Å)
PDBe Citation   
Small molecules:    search PLP PLP binding statistics PLP   search TRS TRS binding statistics TRS
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKA
FKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRR
ALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGT
MNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPV
HRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOC
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF2PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchO15382
JMol viewer RasMol script viewer  TRS 371B  ..                                                                                                                                                                                                                                                                                                                                                                             
JMol viewer RasMol script viewer  TRS 371A  ..                                                                          *                                                                 *                                                            *    *                                *                                                                                                                             
JMol viewer RasMol script viewer  PLP 370A  ..                                                                          |                       *                                         |                                                  *         |    *                             * ****                       * ***                                         **                                                    
sec str:  .......hhhhhee........................eeeeeeee..ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee............eeeeeeeeee...........eeeee................hhhhhhhhhhhhhhhhhh...ee..ee....ee......eeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhh..eeeeeeee...eeeeeeeeee..eeee.hhhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | || ||    | |     |  |      |  |       | | |         ^***|  |  | | |            | |                   | |                | || ||  |  |         |   |||                    |  |        | |    | |||  ||    |  |      || |||         | |  | | |      || |||      | |   | |  | |  |   |||||       | | |     ||||||  |    |         |  |                  |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**| ||    ^**     |  |      |  |       | | |             |  |  | | |            | |                   | |                | || ||  |  |         |   |||                    |  |        | |    | |||  ||    |  |      || |||         | |  | | |      || |||      | |   | |  | |  |   |||||       ^** |     ||||||  |    |         |  |                  |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     || ||    | |     |  |      ^***       | | |             |  |  | | |            | |                   | |                | || ||  |  |         |   |||                    |  |        | |    | |||  ||    |  |      || |||         | |  | | |      ^***||      | |   | |  | ^***   ^***|       |   |     ||||||  |    |         |  |                  |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     || ||    | |     |  |                 | | |             |  |  | | |            | |                   | |                | || ||  |  |         |   |||                    |  |        | |    | |||  ||    |  |      || |||         | |  | | |       | |||      | |   | |  |         ||||       |   |     ||||||  |    |         |  |                  *******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     || ||    | |     |  |                 | | |             |  |  | | |            | |                   | |                | || ||  |  |         ^*****|                    |  |        | |    | ^*****|    |  |      || |||         | |  | | |       | |||      | |   | |  |         ||||       |   |     ||||||  ^*****         |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..     || ||    | |     |  |                 | | |             |  |  | | |            | |                   | |                | || ||  |  |             | |                    |  |        | |    |  ||  ||    |  |      || |||         | |  ***********************************         ||||       |   |     ||||||                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     || ||    | |     |  |                 *****             |  |  | | |            | |                   | |                | || ||  |  |             | |                    |  |        | |    |  ||  ||    |  |      || |||         | |  | | |       | |||      | |   | |            ||||       |   |     ||||||                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..     || ||    | |     |  |                 ***               |  |  | | |            | |                   | |                | || ||  |  |             | |                    |  |        ***    |  ||  ||    |  |      || |||         | |  | | |       | |||      | |   | |            ||||       |   |     ||||||                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..     || ||    | |     |  |                 | |               |  |  | | |            | |                   | |                | || ||  |  |             | |                    |  |               |  ||  ||    |  |      || |||         | |  | | |       | |||      | |   | |            ||||       |   |     ||||**                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..     *****    | |     ****                 | |               ******* | |            | |                   | |                ******|  ****             | |                    |  |               ****|  ||    ****      |****|         | |  | | |       ****|      | |   | |            ||||       |   |     ||||                   ****                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |    | |     |  |                 ***               |  |    | |            | |                   | |                   |  |  |  |             | |                    |  |                   |  ||              |  | |         | |  | ***         | |      ***   ***            ||||       |   |     ||||                                                |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |     |  |                                   |  |    ***            ***                   ***                   |  |  |  |             | |                    |  |                   |  ||              |  ***         ***  |             ***            |              ****       |   |     ****                                                **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    | |     ****                                   ****                                                               ****  ****             ***                    ****                   ****|              |    |              |                            |                         |   |      ***                                                     ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              | |                                                                                                                                      | |                                               |              ******              |                            |                         |   |                                                                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..              | |                                                                                                                                      | |                                               |                                  |                            |                         *****                                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                                                                                                                                      ***                                               |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                         *                                  *                            *                                                                                                   

chain B : BRANCHED CHAIN AMINO ACID AMINOTRANSFERASE (MITOC
member of: CATH:search3.20.10.10/search3.30.470.10GENE3D:searchG3DSA_3.20.10.10/searchG3DSA_3.30.470.10PANTHER:searchPTHR11825/searchPTHR11825_SF2PFAM:searchPF01063PIRSF:searchPIRSF006468PROSITE PATTERNS:searchPS00770, SUPERFAMILY:searchSSF56752TIGRFAMS:searchTIGR01123UniProt:searchO15382
JMol viewer RasMol script viewer  TRS 371B  ..                                                                          *                                                                                                                              *    *                                *                                                                                                                             
JMol viewer RasMol script viewer  PLP 370B  ..                                                                          |                       *                                                                                            *         *    *                             * ****                       * ***                                         **                                                    
JMol viewer RasMol script viewer  TRS 371A  ..                                                                          |                       |                                                                                            |         |    |                             | ||||                       | |||                                         ||                                                    
sec str:  .......hhhhhee........................eeeeeeee..ee...eeee...eee...hhhhhh..eee..eeeee.....eeeehhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh......eeeeeeeeee............eeeeeeeeee...........eeeee................hhhhhhhhhhhhhhhhhh...ee..ee....ee......eeeeeee.....eeeee.........hhhhhhhhhhhhhhh..eeee...hhhhhhhhhhhh.eeeeeeee...eeeeeeeeee..eeee.hhhhhhhhhhhhhhhhhhhhhh.......eee.
sequence :  ..ASSSFKAADLQLEMTQKPHKKPGPGEPLVFGKTFTDHMLMVEWNDKGWGQPRIQPFQNLTLHPASSSLHYSLQLFEGMKAFKGKDQQVRLFRPWLNMDRMLRSAMRLCLPSFDKLELLECIRRLIEVDKDWVPDAAGTSLYVRPVLIGNEPSLGVSQPRRALLFVILCPVGAYFPGGSVTPVSLLADPAFIRAWVGGVGNYKLGGNYGPTVLVQQEALKRGCEQVLWLYGPDHQLTEVGTMNIFVYWTHEDGVLELVTPPLNGVILPGVVRQSLLDMAQTWGEFRVVERTITMKQLLRALEEGRVREVFGSGTACQVCPVHRILYKDRNLHIPTMENGPELILRFQKELKEIQYGIRAHEWMFPV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | || ||    | |         | | | |  |       | |           ^***|  |  ||| |            | |                   | |                  || ||| |  |         |   |||                    |  |        | |      | |  |||  ||  |      || |||         | |  | | |      |  | |        ||||| |  | |  |   |||||       | | |     ||||||  |    |         |  |                  |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ^**| ||    ^**         | | | |  |       | |               |  |  ||| |            | |                   | |                  || ||| |  |         |   |||                    |  |        | |      | |  |||  ||  |      || |||         | |  | | |      |  | |        ||||| |  | |  |   |||||       ^** |     ||||||  |    |         |  |                  |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     || ||    | |         | | | ^***       | |               |  |  ||| |            | |                   | |                  || ||| |  |         |   |||                    |  |        | |      | |  |||  ||  |      || |||         | |  | | |      ^*** |        ||||| |  | ^***   ^***|       |   |     ||||||  |    |         |  |                  |      |||| |  |   
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..     || ||    | |         | | | |          | |               |  |  ||| |            | |                   | |                  || ||| |  |         |   |||                    |  |        | |      | |  |||  ||  |      || |||         | |  | | |         | |        ||||| |  |         ||||       |   |     ||||||  |    |         |  |                  *******^||| |  |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     || ||    | |         | | | |          | |               |  |  ||| |            | |                   | |                  || ||| |  |         ^*****|                    |  |        | |      ^*****||  ||  |      || |||         | |  | | |         | |        ||||| |  |         ||||       |   |     ||||||  ^*****         |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  AA_TRANSFER_CLASS_4 ..     || ||    | |         | | | |          | |               |  |  ||| |            | |                   | |                  || ||| |  |             | |                    |  |        | |        |  |||  ||  |      || |||         | |  ***********************************         ||||       |   |     ||||||                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     || ||    | |         | | | |          | |               |  *****| |            | |                   | |                  || ||| |  |             | |                    |  |        | |        |  |||  ||  |      || |||         | |  | | |         | |        ||||| |            ||||       |   |     ||||||                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..     || ||    | |         | | | |          ***               |  |  | | |            ***                   | |                  || ||| |  |             | |                    |  |        ***        |  |||  ||  |      || |||         | |  | | |         | |        ||||| |            ||||       |   |     ||||||                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betabulge ..     || ||    | |         | | | |                            |  |  | | |            | |                   | |                  || ||| |  |             | |                    |  |                   |  |||  ||  |      || |||         | |  | | |         | |        ||||| |            ||||       |   |     ||||**                 |  |                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..     *****    | |         | | | |                            ******* | |            | |                   | |                  ****|| |  |             | |                    |  |                   |  ||********      |****|         | |  | | |         | |        ||||| |            ||||       |   |     ||||                   ****                         |||| |  |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      |  |    | |         *** | |                            |  |    | |            | |                   | |                   |  || |  |             | |                    |  |                   |  ||              |  | |         | |  | ***         | |        ||||***            ||||       |   |     ||||                                                |||| |  |   
search RasMol script viewer Motif-ligand binding stats  nest ..      |  |    | |             ***                            |  |    ***            ***                   ***                   |  || |  |             | |                    |  |                   |  ||              |  ***         ***  |             ***        ****|              ****       |   |     ****                                                **** |  |   
search RasMol script viewer Motif-ligand binding stats  niche ..      ****    | |             ***                            ****                                                               **********             ***                    ****                   ****|              |    |              |                            |                         |   |      ***                                                     ****   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              | |                                                                                                                                                                                        |              ******              |                            |                         |   |                                                                     
search RasMol script viewer Motif-ligand binding stats  stmotif ..              | |                                                                                                                                                                                        |                                  |                            |                         *****                                                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..              ***                                                                                                                                                                                        |                                  |                            |                                                                                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                                                                                                         *                                  *                            *                                                                                                   

   New search    1ekv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors