triangle PDBeMotif: 1egi  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification sugar binding protein    | release date: Tue, Feb 15, 2000
Title structure of a c-type carbohydrate-recognition domain (crd- 4) from the macrophage mannose receptor
Authors A.R.KOLATKAR, C.T.HEISE, H.FEINBERG, M.E.TAYLOR, S.PARK-SNYDER, W.I.WEIS
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search CA CA binding statistics CA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GIPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGS
PSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTPKPD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MACROPHAGE MANNOSE RECEPTOR
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_3.10.100.10PANTHER:searchPTHR22803/searchPTHR22803_SF55PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchP22897
JMol viewer RasMol script viewer  CA 803A  ..         ..                                                                ..                  *                                     
JMol viewer RasMol script viewer  CA 801A  ..         ..                                                                ..                  * **                                  
sec str:  .......ee......eeeee........hhhhhhhhhhh...ee....hhhhhhhhhhhhhhhh....eeeeeee........................hhhhh..eeeeee......eeeee.....eeeeee.
sequence :  ..CPEDWGASS..SLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYG..GFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQ
seq num:  ..628      ..639       649       659       669       679       689       699 ..707       717       727       737       747       757   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |   ^*..          |  | |  ||   || |||   |             || |||  |   |||   ..  |  |||   |   |  |         |       | |  | ||||     |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |     ..          |  | ^***|   || |||   |             || |||  |   |||   ..  ^***||   |   |  |         |       | ^*** ||||     |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |     ..          |  | |   |   || |^*****             || |||  |   |^****..     |^*****   |  |         |       | |    ||||     |   
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 .. | |     ..          |  | |   |   || |||                 || |||  |   | |   ..     | |       |  |         ^***************^*******^   
search RasMol script viewer Motif-ligand binding stats  asxturn .. | |     ..          |  | |   |   || |||                 || |||  |   | |   ..     | |       |  |                 | |    ***|         
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |     ..          |  | |   |   |****|                 |****|  |   | |   ..     | |       ****                 | |    |  |         
search RasMol script viewer Motif-ligand binding stats  gammaturn .. ***     ..          |  | |   |   |  | |                 |  | |  |   | |   ..     | |       |  |                 | |    |  |         
search RasMol script viewer Motif-ligand binding stats  nest ..         ..          |  | |   |   |  ***                 |  ***  |   | |   ..     ***       |  |                 ***    |  |         
search RasMol script viewer Motif-ligand binding stats  niche ..         ..          **** |   |   |    |                 |    ****   ***   ..               ****                        ****         
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..         ..               |   |   ******                 ******            ..                                                        
search RasMol script viewer Motif-ligand binding stats  ststaple ..         ..               *****                                            ..                                                        

chain B : MACROPHAGE MANNOSE RECEPTOR
member of: CATH:search3.10.100.10GENE3D:searchG3DSA_3.10.100.10PANTHER:searchPTHR22803/searchPTHR22803_SF55PFAM:searchPF00059PROSITE PATTERNS:searchPS00615, PROSITE PROFILES:searchPS50041, SMART:searchSM00034SUPERFAMILY:searchSSF56436UniProt:searchP22897
JMol viewer RasMol script viewer  CA 802B  ..                                                                                                                          **                   
sec str:  ..........ee.....eeeeee..hhhhh.hhhhhhhhhhhh..ee....hhhhhhhhhhhhhh......eeeeeee..........................hhhhh..eeeeee......eeeee.....eeeeeee.....
sequence :  ..IPKCPEDWGASSRTSLCFKLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHKLFWLGLTYGSPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPTMSWNDINCEHLNNWICQIQKGQTP
seq num:  ..625       635       645       655       665       675       685       695       705       715       725       735       745       755          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..    | |   ^**| |        |  | |  ||   || |||   |    |   |   |   |||| |   |||   | || ||| |||   |   |  |  |  |   |   | | | |  | ||||     |  |  |^*
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |      | |        |  | ^***|   || |||   |    |   |   |   |||| |   |||   ^*** |^***||   |   |  |  |  |   |   | | | ^*** ||||     |  |  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..    | |      | |        |  | |   |   || |^*****    |   |   |   |||| |   |^***** |  | | |^*****   |  |  |  |   |   | | | |    ||||     |  |  |  
search RasMol script viewer Motif-ligand binding stats  C_TYPE_LECTIN_1 ..    | |      | |        |  | |   |   || |||        |   |   |   |||| |   | |     |  | | |||       |  |  |  |   ^***************^*******^  |  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..    | |      | |        |  | |   |   || |||        |   |   |   |||| |   | |     |  | | |||       |  |  |  |       | | | |    ***|        |  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..    | |      | |        |  | |   |   || |||        |   |   |   |||| |   | |     |  | *****       |  |  |  |       | | | |    |  |        |  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | |      | |        |  | |   |   |****|        |   |   |   |||| |   | |     |  | ****|       |  |  |  |       | | | |    |  |        ****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..    ***      | |        |  | |   |   |  | |        |   |   |   |||| |   | |     |  |   | |       |  |  |  |       *** | |    |  |        |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..             | |        |  | |   |   |  ***        |   |   |   **** |   | |     |  |   ***       |  |  |  |       | | ***    |  |        |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..             ***        **** |   |   |    |        |   |   |   |*****   ***     ****             ****  ****       *** | |    ****        ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..             | |             |   |   ******        |   |   |   |                                                      | |                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..             | |             *****                 *****   *****                                                      | |                      
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                      ***                      

   New search    1egi:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors