triangle PDBeMotif: 1dy5  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.1.27.5
Classification hydrolase    | release date: Thu, Jan 27, 2000
Title deamidated derivative of bovine pancreatic ribonuclease
Authors A.ZAGARI, F.SICA, L.ESPOSITO, L.MAZZARELLA, L.VITAGLIANO
Method X-RAY DIFFRACTION (resolution: 0.87Å)
PDBe Citation   
Small molecules:    search ACT ACT binding statistics ACT   search IPA IPA binding statistics IPA   search SO4 SO4 binding statistics SO4
Modified residues:  search IAS IAS binding statistics IAS
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKXGQTNCYQSYSTMS
ITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : RIBONUCLEASE A
member of: CATH:search3.10.130.10GENE3D:searchG3DSA_3.10.130.10PANTHER:searchPTHR11437/searchPTHR11437_SF24PFAM:searchPF00074PRINTS:searchRIBONUCLEASEPRODOM:searchPD000535PROSITE PATTERNS:searchPS00127, SMART:searchSM00092SUPERFAMILY:searchSSF54076UniProt:searchP61823
JMol viewer RasMol script viewer  IPA 803A  ..              *                                *                                                                            
JMol viewer RasMol script viewer  IPA 802A  ..              |                                |                                                              **            
JMol viewer RasMol script viewer  IPA 801A  ..              |                                |      *                                                       ||  *         
JMol viewer RasMol script viewer  IPA 800A  ..              |                                |      |      ***                                              ||  |         
JMol viewer RasMol script viewer  ACT 600A  ..              |                            **  |      |      |||                                              ||  |    *    
JMol viewer RasMol script viewer  SO4 125A  ..          **  |                            ||  |      |      |||                                              ||  |   **    
sec str:  ....hhhhhhhhhhh..........hhhhhhhhhh.........eeeee..hhhhhhhhhhheee........eee....eeeeeeee..........eeeeeeee.eeeeee....eeeeeeee.
sequence :  ..KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKXGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   |  || |||||  |        |  || ||^***  ||    |   |  || |  | |      ||  || | |  |  |   | |||                          |||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  || |||||  |        |  || |||||   ||    |   |  || |  ^**      ||  || | |  |  |   | ^**                          |||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |  || |||||  |        |  || |||||   ||    |   ^***| |           ||  || | |  ^***   |  |                           |||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  || |||||  |        |  || |||||   ||    |   |  || |           ^***** | |         |  |                           |||    
search RasMol script viewer Motif-ligand binding stats  RNASE_PANCREATIC ..   |  || |||||  |        |  || |||||   ^^*****   |  || |            |  |  | |         |  |                           |||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   |  || |||||  |        ***** |||||    |        |  || |            |  |  | |         |  |                           |||    
search RasMol script viewer Motif-ligand binding stats  betabulge ..   |  || |||||  |        |  |  |||||    |        |  || |            |  |  | |         |  |                           **|    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   ********|||  |        *******||||    |        |  ****            |  |  | |         ****                            ||    
search RasMol script viewer Motif-ligand binding stats  nest ..         | |||  |               ****    |        |   |              |  |  | |         |  |                            ||    
search RasMol script viewer Motif-ligand binding stats  niche ..         ********                       |        |   |              ****  ***         ****                            ||    
search RasMol script viewer Motif-ligand binding stats  stmotif ..           |                            |        *****                                                                ||    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..           *                            *                                                                             **    

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : RIBONUCLEASE A
member of: CATH:search3.10.130.10GENE3D:searchG3DSA_3.10.130.10PANTHER:searchPTHR11437/searchPTHR11437_SF24PFAM:searchPF00074PRINTS:searchRIBONUCLEASEPRODOM:searchPD000535PROSITE PATTERNS:searchPS00127, SMART:searchSM00092SUPERFAMILY:searchSSF54076UniProt:searchP61823
JMol viewer RasMol script viewer  IPA 805B  ..                     *                                                                            * *                       
JMol viewer RasMol script viewer  IPA 804B  ..                     |                                            *                               | |                       
JMol viewer RasMol script viewer  IPA 801B  ..                     |                                 *          |                               | |                       
JMol viewer RasMol script viewer  IPA 800B  ..                     |                                 |     **   |  *                            | |                       
JMol viewer RasMol script viewer  ACT 602B  ..                     |     **                          |     ||   |  |                            | |                       
JMol viewer RasMol script viewer  ACT 601B  ..                     |     ||             *            |     ||   |  |              *             | |                       
JMol viewer RasMol script viewer  ACT 600B  ..           *         |     ||             |**          |     ||   |  |              |             | |                  *    
JMol viewer RasMol script viewer  SO4 126B  ..           |         |     ||             |||          |     ||   |  |              | ***         | |                  |    
JMol viewer RasMol script viewer  SO4 125B  ..          **         |     ||           * |||          |     ||   |  |              | |||         | |                 **    
sec str:  ....hhhhhhhhhhh..........hhhhhhhhhh.........eeeee..hhhhhhhhhhheee........eee....eeeeeeee..........eeeeeeee.eeeeee....eeeeeeee.
sequence :  ..KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKXGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121 
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  | |  | |||||  |        |  ||  |^***  ||    |   |  |     | |      |    | | |  |  |   | |||                      | |  ||    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  | |||||  |        |  ||  ||||   ||    |   |  |     ^**      |    | | |  |  |   | ^**                      | |  ||    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |  | |||||  |        |  ||  ||||   ||    |   ^***              |    | | |  ^***   |  |                       | |  ||    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |  | |||||  |        |  ||  ||||   ||    |                     ^***** | |         |  |                       | |  ||    
search RasMol script viewer Motif-ligand binding stats  RNASE_PANCREATIC ..  | |  | |||||  |        |  ||  ||||   ^^*****                            | |         |  |                       | |  ||    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |  | |||||  |        *****  ||||    |                                 | |         |  |                       | |  ||    
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |  ****|||  |        ****   ||||    |                                 | |         |  |                       | |  ||    
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  | |    | |||  |               ||||    |                                 | |         |  |                       ***  ||    
search RasMol script viewer Motif-ligand binding stats  nest ..  | |    | |||  |               ****    |                                 | |         |  |                            ||    
search RasMol script viewer Motif-ligand binding stats  niche ..  | |    ********                       |                                 ***         ****                            ||    
search RasMol script viewer Motif-ligand binding stats  stturn ..  ***      |                            |                                                                             ||    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..           *                            *                                                                             **    

   New search    1dy5:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors