triangle PDBeMotif: 1dsu  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.46
Classification hydrolase (serine protease)    | release date: Fri, Sep 15, 1995
Title human factor d, complement activating enzyme
Authors J.E.VOLANAKIS, L.J.DELUCAS, S.V.L.NARAYANA
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPD
SQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHH
DGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : FACTOR D
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24265/searchPTHR24265_SF83PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00746
sec str:  ................eeeeee..eeeeeeeeee..eeeeehhhhh......eeeee............eeeeeeeee......hhhhhh.eeeeee..........................eeeeee..............eeeeee...hhhh.............eeee..............eeee..eeeeee.............eeeee.hhhhhhhhhhh.
sequence :  ..ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
seq num:  ..16        26        36        47        57        64        74        84        94        104       114       125       134       144       155       165       173       183       193       207       217       226       236     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |    |   |  |      |    ||   || | |   ||  | |      |  | | || | |||         | ||  |||  |      | |            | | |  |  |  |         |  || |            |  | ||||| || ||   |||**^*|||||||  |  |    |   | || ||         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |    |   |  |      |    ||   || | |   ||  | |      |  | | || | ^**         | ||  |||  |      ^**            | | |  |  |  |         |  || |            |  | ||||| |^**|   |^** |^**|||||  |  |    |   | || ||         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    |   |  |      |    ||   || | |   ||  | |      |  | | ^***  |          | |^***||  |                     | | |  |  ^***         |  || |            |  | ^***| || ||   | |  | | |||||  |  |    |   | || ||         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****   |  |      ^*****^***** | |   ||  | |      |  | |  | |  |          | ||   ||  |                     | | |  |  |            |  || |            |  |  || | || ||   | |  | | |||||  |  ^*****   ^*****|         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..           |  |                |  | |   ||  | |      |  | |  | |  |          | ||   ||  |                     | | |  |  |            ^***| |            |  |  || | || ||   | |  | | |||||  |           | ||  |         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..           |  |                |  | ****^*  | |      |  | |  | |  |          | ||   ||  |                     | | |  |  |                | |            |  |  || | || ||   | |  | | |||||  |           | ||  |         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..           |  |                |  |     |   | |      |  | |  | |  |          | ||   ||  |                     | | |  |  |                | |            |  |  || | || ||   | |  ******^*****           | ||  |         |  | |   |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..           |  |                |  |     |   | |      |  | |  | |  |          | ||   ||  |                     | | |  ****                | |            |  ****| | || ||   | |    ****|||              | ||  |         **** |   |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..           |  |                |  |     |   ***      |  | |  | |  |          | ||   ||  |                     | ***  |  |                | |            |  |   | | || ||   | |    | |||||              | ||  |              |   |   
search RasMol script viewer Motif-ligand binding stats  nest ..           |  |                |  |     |            |  | |  | |  |          | ||   ||  |                     | |    |  |                | |            |  |   *****| ||   | |    | ***||              | ||  |              |   |   
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                ****     |            **** **** ****          ****   |****                     ***    ****                ***            ****     *******   ***    | *****              *******              |   |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                        |                                      ******   |                                                                           | |           | ||||                                    *****   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        |                                               |                                                                           ***           | ||||                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                        *                                               *                                                                                         * ****                                            

chain B : FACTOR D
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24265/searchPTHR24265_SF83PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00746
sec str:  ................eeeeee..eeeeeeeeee..eeee.hhhhh......eeeee............eeeeeeeeee.............eeeee..........................eeeeee..............eeeeee...hhhh.............eeee..............eeee..eeeeee.............eeeeehhhhhhhhhhh..
sequence :  ..ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
seq num:  ..16        26        36        47        57        64        74        84        94        104       114       125       134       144       155       165       173       183       193       207       217       226       236     
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..  |    | |||  |      |    ||   || | |   |||  |       |  | | || | |||         |  |  || | |      | |            | |    |  |  |         |  || |            |  | |  || || ||    | **^*|||||||  |  |    |   |  | ||  |      |  |         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |    | |||  |      |    ||   || | |   |||  |       |  | | || | ^**         |  |  || | |      ^**            | |    |  |  |         |  || |            |  | |  || |^**|    ^**||^**|||||  |  |    |   |  | ||  |      |  |         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |    | |||  |      |    ||   || | |   |||  |       |  | | ^***  |          |  ^***| | |                     | |    |  ^***         |  || |            |  | ^***| ||  |    |  || | |||||  |  |    |   |  | ||  |      |  |         
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** |||  |      ^*****^***** | |   |||  |       |  | | || |  |          |  |   | | |                     | |    |  |            |  || |            |  |     | ||  |    |  || | |||||  |  ^*****   ^*****|  |      |  |         
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | |||  |                |  | |   |||  |       |  | | || |  |          |  |   | | |                     | |    |  |            ^***| |            |  |     | ||  |    |  || | |||||  |              |  |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..       | |||  |                |  | ****^*|  |       |  | | || |  |          |  |   | | |                     | |    |  |                | |            |  |     | ||  |    |  || | |||||  |              |  |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..       | |||  |                |  |     | |  |       |  | | || |  |          |  |   | | |                     | |    |  |                | |            |  |     | ||  |    |  |******^*****              |  |  |      |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |                |  |     | |  |       |  | | || |  |          ****   | | |                     | |    ****                | |            |  |     | ||  |    |  |  *******                 |  ****      ****         
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |                |  |     | |  |       |  | | || |  |          |  |   | | |                     | |    |  |                | |            |  |     ***|  |    |  |  | ***||                 |  |                      
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                ****     | ****       **** **** ****          ****   *** |                     ***    ****                ***            ****     *******    ****  | *****                 ****                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        |                 ***                       *** |                                                                                         | ||||                                            
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                        *                                               *                                                                                         * ****                                            

   New search    1dsu:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors