triangle PDBeMotif: 1dgh  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.11.1.6
Classification oxidoreductase    | release date: Wed, Nov 24, 1999
Title human erythrocyte catalase 3-amino-1,2,4-triazole complex
Authors A.S.ARVAI, C.D.PUTNAM, J.A.TAINER, Y.BOURNE
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Small molecules:    search HEM HEM binding statistics HEM   search NDP NDP binding statistics NDP
Modified residues:  search 3AH 3AH binding statistics 3AH
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFG
YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPS
FIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIK
NLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPV
NYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPN
YYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFT
EVHPDYGSHIQALLDKYN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (CATALASE)
member of: GENE3D:searchG3DSA_2.40.180.10PANTHER:searchPTHR11465PFAM:searchPF00199/searchPF06628PIRSF:searchPIRSF038928PRINTS:searchCATALASEPROSITE PATTERNS:searchPS00437/searchPS00438, PROSITE PROFILES:searchPS51402, SMART:searchSM01060SUPERFAMILY:searchSSF56634UniProt:searchP04040
JMol viewer RasMol script viewer  HEM 2002C  ..                                                        *   *                                                                                                                                                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  NDP 3000A  ..                                                        |   |                                                                                     *                                          *   *  * *         *                     * *                                                                ****                                                                                                                                        *   *   *                                                   
JMol viewer RasMol script viewer  HEM 2000A  ..                                                        |   |      ****                                    *                  *              ***  |      *  *                                |   |  | |         |  **                 | |                                                             *  ||||                            *               *   *   *  **  *                                                                            |   |   |                                                   
sec str:  .......hhhhhhhhhh......................eee.........hhhhhhhhhhhh............eeeeeeeeee.........hhhhh....eeeeeeeee................eeeeeeee..eeeeeeee........hhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhh........ee....eeee.....eeeeeeeeee.......hhhhhhhhhhhh.hhhhhhhhhhhhh....eeeeeeeeehhhhhhhh..................eeeeeeeeee...hhhhhh.............ee...hhhhhhhhhhhhhhhhhhh..hhhhhhhhh.....................................hhhhh....eeeeeeee........hhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..RDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYN
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                          |||   |       |  |     |   |    |||| |      | |  |          || || | |  || ||       | | || ||  ||||         | |       | | |    ||| |     | |    | | | |  |   | || ||   |   | ||    |  |   | || |  | |||         | |   ^*** || | |  | ||      |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     |   |  |||      |  || |||  |   | |        |||| |  |    | |   ||||||             |  | ^***     |  |               |  |          ^***                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                          |||   |       |  |     |   |    |||| |      | |  |          || || | |  || ||       | | || ||  ^**|         | |       | | |    ||| |     ^**    | | | |  |   ^**| ||   |   ^**|    |  |   | |^**  | |||         | |     |  || | |  | ||      |   ^**             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     |   |  ^**      |  || |||  |   | |        |||| |  |    | |   ||||||             |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                          |||   |       |  |     |   |    |||| |      | |  |          || || | |  || ||       | | || ||  ^***         | |       | | |    ||| |            | | | |  |   | || ||   |   | ||    |  |   | |     | |||         | |     ^***| | ^*** ||      |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     |   |   |       |  || |||  |   | |        |||| |  |    | |   ||^***             ^***          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                          |||   |       |  |     |   |    |||| |      | |  |          || || | |  || ||       | | || ||   |           | |       | | |    ||| |            | | | |  |   | || ||   |   | ||    |  |   | |     | |||         | |     |   | ********^      |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     |   |   |       |  || |||  |   | |        |||| |  |    | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                          |^*****       |  |     |   |    |||| |      | |  |          || || | |  || ||       | | || ^*****           | |       | | |    ||| |            | | | |  |   | || ||   |   | |^*****  |   | |     | |||         | |     |   |   |  | |       |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     |   |   |       |  || |||  |   | |        |||^*****    | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                          | |           |  |     |   |    |||| |      | |  |          || || | |  |^***       | | ||  |               | |       | | |    ||| |            | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |     |   |   |  | |       |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     |   |   |       |  || |||  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  CATALASE_1 ..                          | |           |  |     |   |    |||| |      | |  |          || || | |  |  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |     |   |   |  | |       |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |     ****^****       |  || |||  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  CATALASE_2 ..                          | |           |  |     |   |    |***********^*****          || || | |  |  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |     |   |   |  | |       |   | |             | ||||  |  |  |           ||    ||        |  |  |  | |  |  | |                     |  || |||  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                          | |           |  |     |   |    | || |      | |             ***** | |  |  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |     |   |   |  | |       |   | |             *****|  |  |  |           ||    ||        |  |  |  | |  |  | |                     |  *****|  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  asxturn ..                          | |           |  |     |   |    | || |      | |             || || | |  |  |        | | ||  |               | |       | | |    *** |            | | ***  |   | || ||   |   | |     |  |   | |     | |||         | |     |   |   |  ***       |   | |             | || |  |  |  |           ||    ||        |  |  |  | |  |  | |                     |  || |||  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  betabulge ..                          | |           |  |     |   |    | || |      | |             || || | |  |  |        | | ||  |               | |       | | |     |  |            | |      |   | || ||   |   | |     |  |   | |     | |||         | |     |   |   |  |         |   | |             | || |  |  |  |           **    **        |  |  |  | |  |  | |                     |  || |||  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                          | |           |  |     |   |    | || |      | |             || || | |  |  |        | | ||  |               | |       | | |     |  |            | |      |   | || ||   |   | |     |  |   | |     *****         | |     |   |   |  |         |   | |             | || |  |  |  |                           |  |  |  | |  |  | |                     |  || |||  |   | |        |||| |       | |   || ||              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                          | |           |  |     |   |    **** |      | |             ****| | |  ****        | | |****               | |       | | |     ****            | |      |   | *****   |   | |     |  |   | |     ****|         | |     |   |   |  |         |   | |             **** |  |  |  |                           ****  **** ****  | |                     |  ****||  |   | |        ******       | |   ****|              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                          | |           |  |     |   |      |  |      | |              |  | | |  |  |        | | ||  |               | |       | | |                     | |      |   |     |   |   | |     |  |   ***       | |         | |     |   |   |  |         |   | |               |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |        |||| |       | |    |  |              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                          ***           |  |     |   |      |  |      ***              |  | | |  |  |        | | ||  |               | |       | | |                     ***      |   |     |   |   | |     |  |             ***         | |     |   |   |  |         |   ***               |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |        ***| |       ***    |  |              |  |          |  |               |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                                        ****     |   |      ****      ***              ****** *******        | *******               | |       | | |                     | |      |   |     |   |   | |     ****                         | |     |   |   ****         |   |                 ****  *******                           ****  **** ****  ***                     ************   ***         *****              ****              ****          ****               ****                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                 |   |                |                   | |                |                       | |       | | |                     | |      |   |     |   |   | |                                  | |     *****                |   |                                                                                                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                 *****                |                   | |                |                       | |       | | |                     | |      *****     *****   | |                                  | |                          *****                                                                                                                                                                                                                                      
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                      |                   ***                |                       ***       | ***                     ***                        ***                                  ***                                                                                                                                                                                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                      *                                      *                                 *                                                                                                                                                                                                                                                                                                                                                                 

chain B : PROTEIN (CATALASE)
member of: GENE3D:searchG3DSA_2.40.180.10PANTHER:searchPTHR11465PFAM:searchPF00199/searchPF06628PIRSF:searchPIRSF038928PRINTS:searchCATALASEPROSITE PATTERNS:searchPS00437/searchPS00438, PROSITE PROFILES:searchPS51402, SMART:searchSM01060SUPERFAMILY:searchSSF56634UniProt:searchP04040
JMol viewer RasMol script viewer  HEM 2003D  ..                                                         *   *                                                                                                                                                                                                                                                                                                                                                                                                                                                    
JMol viewer RasMol script viewer  HEM 2001B  ..                                                         |   |      ****                                    *                  *              ***         *  *                                                      **                                                                                 *                                  *               *   *  **  **  *                                                                                                                                        
sec str:  ........hhhhhhhhh.......................eee.........hhhhhhhhhhhh............eeeeeeeeee.........hhhhh....eeeeeeeee................eeeeeeee..eeeeeeee........hhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhh........ee....eeee.....eeeeeeeeee.......hhhhhhhhhhhh.hhhhhhhhhhhhh....eeeeeeeeehhhhhhhh..................eeeeeeeeee...hhhhhh.............eee..hhhhhhhhhhhhhhhhhhh..hhhhhhhhh.....................................hhhhh...ee...eeee........hhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYN
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                ||||     | |||   |  |    |  |  |  |   |    || | |      | |  |         ||| || |    || ||       | | || ||  ||||         | |       | | |    ||| |     | | |  | | | |  |   | || ||   |   | ||    |  |   | || |  | |||         | |   ^*** |  | |  |  |      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |  |||     || ||| |||  |   | |  |  |  |||| |  |    | |   ||||||             |  | ^***     |  ||   |          |  |          ^***  |   |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                ||||     | |||   |  |    |  |  |  |   |    || | |      | |  |         ||| || |    || ||       | | || ||  ^**|         | |       | | |    ||| |     ^** |  | | | |  |   ^**| ||   |   ^**|    |  |   | |^**  | |||         | |     |  |  | |  |  |      |   ^**           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |  ^**     || ||| |||  |   | |  |  |  |||| |  |    | |   ||||||             |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                ||||     | |||   |  |    |  |  |  |   |    || | |      | |  |         ||| || |    || ||       | | || ||  ^***         | |       | | |    ||| |         |  | | | |  |   | || ||   |   | ||    |  |   | |     | |||         | |     ^***  | ^***  |      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||| |  |    | |   ||^***             ^***          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                ||||     | |||   |  |    |  |  |  |   |    || | |      | |  |         ||| || |    || ||       | | || ||   |           | |       | | |    ||| |         |  | | | |  |   | || ||   |   | ||    |  |   | |     | |||         | |           ********^      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||| |  |    | |   || ||              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                ||||     | |^*****  |    |  |  |  |   |    || | |      | |  |         ||| || |    || ||       | | || ^*****           | |       | | |    ||| |         |  | | | |  |   | || ||   |   | |^*****  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||^*****    | |   || ||              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                ||||     | |||   |  |    |  |  |  |   |    || | |      | |  |         ||| || |    |^***       | | ||  |               | |       | | |    ||| |         |  | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  CATALASE_1 ..                ||||     | |||   |  |    |  |  |  |   |    || | |      | |  |         ||| || |    |  |        | | ||  |               | |       | | |    ||| |         |  | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   ****^****      || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  CATALASE_2 ..                ||||     | |||   |  |    |  |  |  |   |    |***********^*****         ||| || |    |  |        | | ||  |               | |       | | |    ||| |         |  | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |                  || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                ||||     | |||   |  |    |  |  |  |   |    |  | |      | |            |***** |    |  |        | | ||  |               | |       | | |    ||| |         |  | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |                  || |*****|  |   | |  |  |  |||| |       | |   || ||              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                ||||     | |||   |  |    |  |  |  |   |    |  | |      | |            ||| || |    |  |        | | ||  |               | |       | | |    ||| |         |  | | | |  |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||   *****|  |  |  | |  |  | | |                  || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  |*****          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                ||||     | |||   |  |    |  |  |  |   |    |  | |      | |            *** || |    |  |        | | ||  |               | |       | | |    *** |         |  | | ***  |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           ||    ||        |  |  |  | |  |  | ***                  || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..                ||||     | |||   |  |    |  |  |  |   |    |  | |      | |             || || |    |  |        | | ||  |               | |       | | |     |  |         |  | |      |   | || ||   |   | |     |  |   | |     | |||         | |             |  |         |   | |           |   |  |  |  |  |           **    **        |  |  |  | |  |  | |                    || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                ||||     *****   |  |    |  |  |  |   |    |  | |      | |             || || |    |  |        | | ||  |               | |       | | |     |  |         ******      |   | || ||   |   | |     |  |   | |     *****         | |             |  |         |   | |           |   |  |  |  |  |                           |  |  |  | |  |  | |                    || ||| |||  |   | |  |  |  |||| |       | |   || ||              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ||||     ****|   |  |    |  |  ****   |    **** |      | |             ****| |    ****        | | ||  |               | |       | | |     ****            | |      |   | *****   |   | |     |  |   | |     ****|         | |             |  |         |   | |           |   |  |  |  |  |                           |  |  **** ****  | |                    ********||  |   | |  |  |  ******       | |   ****|              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                ***|       | |   |  |    |  |     |   |       | |      | |              |  | |    |  |        | | ||  |               | |       | | |                     | |      |   |     |   |   | |     |  |   ***       | |         | |             |  |         |   | |           |   |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |  |  |  |||| |       | |    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                 | |       ***   |  |    |  |     |   |       | |      ***              |  | |    |  |        | | ||  |               | |       | | |                     ***      |   |     |   |   | |     |  |             ***         | |             |  |         |   ***           |   |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |  |  |  ***| |       ***    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                 ***             ****    ****     |   |       ***      ***              ******    ****        | *******               | |       | | |                              |   |     |   |   | |     ****                         | |             ****         |   |             |   ****  *******                           ****  **** ****  ***                     ************   ***  ****   *****              ****              ****          ****               ****                |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                  |   |                |                   | |                |                       | |       | | |                              |   |     |   |   | |                                  | |                          |   |             *****                                                                                                                                                                                                     |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                  *****                |                   | |                |                       | |       | | |                              *****     *****   | |                                  | |                          *****                                                                                                                                                                                                                       *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                       |                   ***                |                       ***       | ***                                                ***                                  ***                                                                                                                                                                                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                       *                                      *                                 *                                                                                                                                                                                                                                                                                                                                                                 

chain C : PROTEIN (CATALASE)
member of: GENE3D:searchG3DSA_2.40.180.10PANTHER:searchPTHR11465PFAM:searchPF00199/searchPF06628PIRSF:searchPIRSF038928PRINTS:searchCATALASEPROSITE PATTERNS:searchPS00437/searchPS00438, PROSITE PROFILES:searchPS51402, SMART:searchSM01060SUPERFAMILY:searchSSF56634UniProt:searchP04040
JMol viewer RasMol script viewer  NDP 3001C  ..                                                                                                                                                   *                                          *   *  * *         *                     * *    *                                                           ****                                                                                                                                        *   *   *                                                   
JMol viewer RasMol script viewer  HEM 2002C  ..                                                                    ****                                    *                  *              ***  | *    *  *                                |   |  | |         |  **                 | |    |                                                        *  ||||                            *               *   *  **  **  *                                                                            |   |   |                                                   
JMol viewer RasMol script viewer  HEM 2000A  ..                                                         *          ||||                                    |                  |              |||  | |    |  |                                |   |  | |         |  ||                 | |    |                                                        |  ||||                            |               |   |  ||  ||  |                                                                            |   |   |                                                   
sec str:  ........hhhhhhhhhh......................eee.........hhhhhhhhhhhh............eeeeeeeeee.........hhhhh....eeeeeeeee................eeeeeeee..eeeeeeee........hhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhh........ee....eeee.....eeeeeeeeee.......hhhhhhhhhhhh.hhhhhhhhhhhhh....eeeeeeeeehhhhhhhh..................eeeeeeeeee...hhhhhh.............eee..hhhhhhhhhhhhhhhhhhh..hhhhh.........................................hhhhh...ee...eeee........hhhhhhhhhhh.hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYN
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                ||||     | |||   |  |    |  |     |   |    |||| |      | |  |          || || ||  ||| ||       | | || ||  ||||         | |       | | |    ||| |     | |    | | | |  |   | |  ||   |   | ||    |      | || |    | |         | |   ^*** |  | |  |  |      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |  |||     || ||| |||  |   | |        |||| |  |    | |   ||||||             | |||^***     |  |               |  |          ^*** || |||          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                ||||     | |||   |  |    |  |     |   |    |||| |      | |  |          || || ||  ||| ||       | | || ||  ^**|         | |       | | |    ||| |     ^**    | | | |  |   ^**  ||   |   ^**|    |      | |^**    | |         | |     |  |  | |  |  |      |   ^**           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |  ^**     || ||| |||  |   | |        |||| |  |    | |   ||||||             | |||         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                ||||     | |||   |  |    |  |     |   |    |||| |      | |  |          || || ||  ||| ||       | | || ||  ^***         | |       | | |    ||| |            | | | |  |   | |  ||   |   | ||    |      | |       | |         | |     ^***  | ^***  |      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |        |||| |  |    | |   ||^***             ^***|         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                ||||     | |||   |  |    |  |     |   |    |||| |      | |  |          || || ||  ||| ||       | | || ||   |           | |       | | |    ||| |            | | | |  |   | |  ||   |   | ||    |      | |       | |         | |           ********^      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |        |||| |  |    | |   || ||                | |         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                ||||     | |^*****  |    |  |     |   |    |||| |      | |  |          || || ||  ||| ||       | | || ^*****           | |       | | |    ||| |            | | | |  |   | |  ||   |   | |^*****      | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |        |||^*****    | |   || ||                | |         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                ||||     | | |   |  |    |  |     |   |    |||| |      | |  |          || || ||  ||^***       | | ||  |               | |       | | |    ||| |            | | | |  |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |        |||| |       | |   || ||                | |         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  CATALASE_1 ..                ||||     | | |   |  |    |  |     |   |    |||| |      | |  |          || || ||  ||  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   ****^****      || ||| |||  |   | |        |||| |       | |   || ||                | |         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  CATALASE_2 ..                ||||     | | |   |  |    |  |     |   |    |***********^*****          || || ||  ||  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |                  || ||| |||  |   | |        |||| |       | |   || ||                | |         |  |               |  |               || |||          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                ||||     | | |   |  |    |  |     |   |    | || |      | |             ***** ||  ||  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |                  || |*****|  |   | |        |||| |       | |   || ||                | |         |  |               |  |               *****|          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                ||||     | | |   |  |    |  |     |   |    | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |    ||| |            | | | |  |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||   *****|  |  |  | |  |  | | |                  || ||| |||  |   | |        |||| |       | |   || ||                | |         |  |               |  |               || | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                ||||     | | |   |  |    |  |     |   |    | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |    *** |            | | ***  |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           ||    ||        |  |  |  | |  |  | ***                  || ||| |||  |   | |        |||| |       | |   || ||                | |         |  |               |  |               || | |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..                ||||     | | |   |  |    |  |     |   |    | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |     |  |            | |      |   | |  ||   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |           **    **        |  |  |  | |  |  | |                    || ||| |||  |   | |        |||| |       | |   || ||                | |         |  |               |  |               || | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ||||     | | |   |  |    |  |     |   |    **** |      | |             ****| |****|  |        | | ||  |               | |       | | |     ****            | |      |   | ****|   |   | |            | |       | |         | |                          |   | |           |   |  |  |  |  |                           |  |  **** ****  | |                    ********||  |   | |        ******       | |   ****|                | |         |  |               ****               **** |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                ****     | | |   |  |    |  |     |   |      |  |      | |              |  | |    |  |        | | ||  |               | |       | | |                     | |      |   |     |   |   | |            ***       | |         | |                          |   | |           |   |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |        |||| |       | |    |  |                ***         |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                 | |     | ***   |  |    |  |     |   |      |  |      ***              |  | |    |  |        | | ||  |               | |       | | |                     ***      |   |     |   |   | |                      ***         | |                          |   ***           |   |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |        ***| |       ***    |  |                            |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                 ***     | |     ****    ****     |   |      ****      ***              ******    ****        | *******               | |       | | |                     | |      |   |     |   |   | |                                  | |                          |   |             |   ****  *******                           ****  **** ****  ***                     ************   ***         *****              ****                            ****               ****                |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         | |                      |   |                |                   | |                |                       | |       | | |                     | |      |   |     |   |   | |                                  | |                          |   |             *****                                                                                                                                                                                                     |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |                      *****                |                   | |                |                       | |       | | |                     | |      *****     *****   | |                                  | |                          *****                                                                                                                                                                                                                       *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***                                           |                   ***                |                       ***       | ***                     ***                        ***                                  ***                                                                                                                                                                                                                                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                       *                                      *                                 *                                                                                                                                                                                                                                                                                                                                                                 

chain D : PROTEIN (CATALASE)
member of: GENE3D:searchG3DSA_2.40.180.10PANTHER:searchPTHR11465PFAM:searchPF00199/searchPF06628PIRSF:searchPIRSF038928PRINTS:searchCATALASEPROSITE PATTERNS:searchPS00437/searchPS00438, PROSITE PROFILES:searchPS51402, SMART:searchSM01060SUPERFAMILY:searchSSF56634UniProt:searchP04040
JMol viewer RasMol script viewer  HEM 2003D  ..                                                                    ****                                    *                  *              ***         *  *                                                      **                                                                                 *                                  *               *   *  **  **  *                                                                                                                                        
JMol viewer RasMol script viewer  HEM 2001B  ..                                                         *          ||||                                    |                  |              |||         |  |                                                      ||                                                                                 |                                  |               |   |  ||  ||  |                                                                                                                                        
sec str:  ........hhhhhhhhh.......................eee.........hhhhhhhhhhhhh...........eeeeeeeeee.........hhhhh....eeeeeeeee................eeeeeeee..eeeeeeee........hhhhhhhhhhhhh........hhhhhhhhhhhh..hhhhhhhhhhhhhh........ee....eeee.....eeeeeeeeee.......hhhhhhhhhhhh.hhhhhhhhhhhhh....eeeeeeeeehhhhhhhh..................eeeeeeeeee...hhhhhh.............ee...hhhhhhhhhhhhhhhhhhh..hhhhhhhhh.....................................hhhhh....eeeeeeee........hhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh
sequence :  ..SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYN
seq num:  ..4         14        24        34        44        54        64        74        84        94        104       114       124       134       144       154       164       174       184       194       204       214       224       234       244       254       264       274       284       294       304       314       324       334       344       354       364       374       384       394       404       414       424       434       444       454       464       474       484       494     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..                         | |||   |  |    |  |     | |      |||| |      | |  |          || || ||  ||| ||       | | || ||  ||||         | |       | | |    ||| |    || |    | | | |      | |  |        | ||    |         | |  | |||               ^*** || | |  |  |      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |  |||     || ||| |||  |   | |  |  |  |||| |  |    | |    || ||             |  | ^***     |  ||   |          |  |          ^***  |   |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..                         | |||   |  |    |  |     | |      |||| |      | |  |          || || ||  ||| ||       | | || ||  ^**|         | |       | | |    ||| |    |^**    | | | |      ^**  |        ^**|    |         ^**  | |||                 |  || | |  |  |      |   ^**           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |  ^**     || ||| |||  |   | |  |  |  |||| |  |    | |    || ||             |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                         | |||   |  |    |  |     | |      |||| |      | |  |          || || ||  ||| ||       | | || ||  ^***         | |       | | |    ||| |    |  |    | | | |        |  |        | ||    |              | |||                 ^***| | ^***  |      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||| |  |    | |    |^***             ^***          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                         | |||   |  |    |  |     | |      |||| |      | |  |          || || ||  ||| ||       | | || ||   |           | |       | | |    ||| |    |  |    | | | |        |  |        | ||    |              | |||                 |   | ********^      |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||| |  |    | |    |  |              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                         | |^*****  |    |  |     | |      |||| |      | |  |          || || ||  ||| ||       | | || ^*****           | |       | | |    ||| |    |  |    | | | |        |  |        | |^*****              | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||^*****    | |    |  |              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                         | | |   |  |    |  |     | |      |||| |      | |  |          || || ||  ||^***       | | ||  |               | |       | | |    ||| |    |  |    | | | |        |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   |   |   |      || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  CATALASE_1 ..                         | | |   |  |    |  |     | |      |||| |      | |  |          || || ||  ||  |        | | ||  |               | |       | | |    ||| |    |  |    | | | |        |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |   ****^****      || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  CATALASE_2 ..                         | | |   |  |    |  |     | |      |***********^*****          || || ||  ||  |        | | ||  |               | |       | | |    ||| |    |  |    | | | |        |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |                  || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                         | | |   |  |    |  |     | |      | || |      | |             ***** ||  ||  |        | | ||  |               | |       | | |    ||| |    |  |    | | | |        |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||   |   ||  |  |  | |  |  | | |                  || |*****|  |   | |  |  |  |||| |       | |    |  |              |  |          |  ||   |          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                         | | |   |  |    |  |     | |      | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |    ||| |    |  |    | | | |        |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||   *****|  |  |  | |  |  | | |                  || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  |*****          |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..                         | | |   |  |    |  |     ***      | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |    *** |    |  |    | | ***        |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           ||    ||        |  |  |  | |  |  | ***                  || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  betabulge ..                         | | |   |  |    |  |              | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |     |  |    |  |    | |            |  |        | |                    | |||                 |   |                |   | |           |   |  |  |  |  |           **    **        |  |  |  | |  |  | |                    || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                         | | |   |  |    |  |              | || |      | |             || || ||  ||  |        | | ||  |               | |       | | |     |  |    |  |    | |            |  |        | |                    *****                 |   |                |   | |           |   |  |  |  |  |                           |  |  |  | |  |  | |                    || ||| |||  |   | |  |  |  |||| |       | |    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..                         | | |   |  |    |  |              **** |      | |             ****| |********        | | ||  |               | |       | | |     ****    ****    | |            ****        | |                    ****|                 |   |                |   | |           |   |  |  ****  |                           |  |  **** ****  | |                    ********||  |   | |  |  |  ******       | |    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..                         | ***   |  |    |  |                |  |      ***              |  | |    |  |        | | ||  |               | |       | | |                     ***                        | |                      ***                 |   |                |   ***           |   |  |  |  |  |                           |  |  |  | |  |  | |                     |  ||  ||  |   | |  |  |  ***| |       ***    |  |              |  |          |  |               |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..                         | |     ****    ****                ****      ***              ******    ****        | *******               | |       | | |                                                | |                                          |   |                |   |             |   ****  *******                           ****  **** ****  ***                     ************   ***  ****   *****              ****              ****          ****               ****                |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..                         | |                                           |                   | |                |                       | |       | | |                                                | |                                          *****                |   |             *****                                                        | |                                                                                                                                          |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..                         | |                                           |                   | |                |                       | |       | | |                                                | |                                                               *****                                                                          | |                                                                                                                                          *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..                         ***                                           |                   ***                |                       ***       | ***                                                ***                                                                                                                                              ***                                                                                                                                                         
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                       *                                      *                                 *                                                                                                                                                                                                                                                                                                                                                                 

   New search    1dgh:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors