triangle PDBeMotif: 1d7w  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.11.1.7
Classification oxidoreductase    | release date: Wed, Oct 20, 1999
Title crystal structure of human myeloperoxidase isoform c complex cyanide and bromide at ph 4.0
Authors R.E.FENNA, T.J.FIEDLER
Method X-RAY DIFFRACTION (resolution: 1.90Å)
PDBe Citation   
Small molecules:    search BMA BMA binding statistics BMA   search NAG NAG binding statistics NAG   search HEM HEM binding statistics HEM   search ACT ACT binding statistics ACT   search FUC FUC binding statistics FUC   search BR BR binding statistics BR   search MAN MAN binding statistics MAN   search SO4 SO4 binding statistics SO4   search CA CA binding statistics CA   search CYN CYN binding statistics CYN
Modified residues:  search CSO CSO binding statistics CSO search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQ
ERSLMFMQWGQLLDHDLDFTPEPA
Chains C,D sequence:
VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSN
QLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWD
GERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQP
MEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPG
YNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRF
WWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MYELOPEROXIDASE
member of: GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  NAG 2641D  ..                                *                                                                       
JMol viewer RasMol script viewer  MAN 2644D  ..                               *|                                                                       
JMol viewer RasMol script viewer  ACT 2611B  ..                               ||                                                                       
JMol viewer RasMol script viewer  ACT 1608B  ..                               ||*                                                                      
JMol viewer RasMol script viewer  SO4 1610C  ..                               |||                                              *                       
JMol viewer RasMol script viewer  CA 1600C  ..                               |||                                              |              *        
JMol viewer RasMol script viewer  HEM 605A  ..                               |||                                              |     *  **  * | ***    
JMol viewer RasMol script viewer  ACT 2608A  ..               *  *  *         |||                                              |     |  ||  | | |||    
JMol viewer RasMol script viewer  CYN 1844A  ..               |  |  |         |||                                              |     |  |*  |*| |||    
JMol viewer RasMol script viewer  SO4 1602A  ..               |  |  |         |||                                      *       |     |  ||  ||| |||    
JMol viewer RasMol script viewer  BR 1601A  ..               |  |  |        **||                                      |       |     |  ||  ||| |||    
sec str:  ............................ee...............................hhhhhhhhhh..hhhhh.eeeeeehhhhhhhhhhhhhhh......
sequence :  ..CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ||||||| | || |^**           | |  | ||| ||   |           |  | || ||  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |^***** | || |  |           | |  | ||| ^*****           |  | || ||  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          ||||||  | || |  |           | |  | |||  |               |  | || ||  | |||  |    | ******      
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ||||||  | || |  |           ***  | |||  |               |  | || ||  ***||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |****|  | || |  |           | |  ****|  |               |  | ****|  |  |****    | *****|      
search RasMol script viewer Motif-ligand binding stats  nest ..          ******  | || |  |           ***    ***  |               |  |  |  |  |  |        |   |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..             ***  *********                  ******               ****  ****  ****        |   ****      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                          *   *         

chain C : MYELOPEROXIDASE
member of: CATH:search1.10.640.10GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  NAG 2640D  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
JMol viewer RasMol script viewer  NAG 2641D  ..                                                                                                                                                                                                                                                                                                                                     ** *                                                                                                                                         
JMol viewer RasMol script viewer  BMA 2642D  ..                                                                                                                                                                                                                                                                                                                                     |* |                                                                                                                                         
JMol viewer RasMol script viewer  MAN 2644D  ..                                                                                                                                                                                                                                                                                                                                     |* |                                                               *                                                                         
JMol viewer RasMol script viewer  MAN 2643D  ..                                                                                                                                                                                                   *                                                                                                                                 || |                                                               |                                                                         
JMol viewer RasMol script viewer  BR 957C  ..                                                                                                                              *  *                                                                 |                                                                                                                                 || |                                                               |                                                                         
JMol viewer RasMol script viewer  BR 889C  ..                                                                                       **          **                         |  |                                                                 |                                                                                                                                 || |                                                               |                                                                         
JMol viewer RasMol script viewer  BR 758C  ..                                                                                       ||          ||                         |  |                                                                 |                                       *                                 *                                                       || |                                                               |                                     ***                                 
JMol viewer RasMol script viewer  ACT 1612C  ..                                                                                       ||          ||                         |  |                                                                 |                                       |                                 |                                                       || |                                                               |                                     |||                                 
JMol viewer RasMol script viewer  ACT 1609C  ..                                                                                       ||          ||                         |  |                                            *                    |                                       |                                 |                                                       || |                                                               |                         **  **  *   |||                        *        
JMol viewer RasMol script viewer  ACT 1607C  ..                                                                                       ||          ||                         |  |                                            |               *   *|                                       |                                 |                                                       || |                                             *                 |                         ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 1604C  ..                                                                                       ||          ||                         |  |                                            |               |   ||                                       |                                 |                                                       || |                                             |                 |                *  *     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 1606C  ..          **                       *            *                                      ||          ||                         |  |                                            |               |   ||                                       |                                 |                                                       || |                                             |                 |                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 1610C  ..          ||                       |            |                                      ||          ||                         |  |                                            |               |   ||                                       |                                 |                                                       || |                                             |* *              |                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 1603C  ..          ||                       |            |                                      ||          ||               *         |  |                                            |               |   ||                                       |                                 |                                                       || |                                             || |              |                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CA 1600C  ..          ||                       |            |      * * * *                         ||          ||               |         |  |                                            |               |   ||                                       |                                 |                                                       || |                                             || |              |                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  FUC 1645C  ..          ||                       |            |      | | | |                         ||          ||               |         |  |                                            |               |   ||           *                           |                                 |                                                       || |                                             || |             *|                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1640C  ..          ||                       |            |      | | | |                         ||          ||               |         |  |                                            |               |   ||        *  *                           |                                 |                                                       || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1641C  ..          ||                       |            |      | | | |                         ||          ||               |         |  |                                            |               |   ||        | *|                           |                                 |                                                       || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1630C  ..          ||                       |            |      | | | |                         ||          ||           *  *|         |  |                                            |               |   ||        | ||                           |                    *   *        |                                                       || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1620C  ..          ||                       |            |      | | | |              *  *   * **|*          ||           |  ||         |  |                                            |               |   ||        | ||                           |                    |   |        |                                                       || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  HEM 605A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         *  **                                           |               |   ||        | ||        *  ** **  *        |                *   |   |        |                       **         *      *             || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 2608A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   ||        |***        |  || ||  |        |                |   |   |        |                       ||         |      |             || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CYN 1844A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   ||        ||||        |  || ||  |        |                |   |   |        |                       ||         |      |             || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 1602A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   ||        ||||        |  || ||  |        |                |   |   |        |                 *    *||         |      |             || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  BR 1601A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   ||        ||||     ** |  || ||  |        |                |   |   |        |                 |    |||         |      |     *     * || |                                             || |             ||                |  |     ||  ||  |   |||                        |        
sec str:  .................ee.............ee...................ee.......hhhhhh.hhhhhhhhh..............................hhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhh..eee.............eee.hhh...hhhhhhh..hhhhhhhhhhheee........hhhhhh..hhhhh....hhhhhhhhhhhhh...hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...........hhhhhhhhh..hhhhhhhhhh...eee.............eee.hhh....hhhhh..
sequence :  ..VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
seq num:  ..113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||| | |  | |     |  | || |  |          | ||^***|      ||| ||||||       |  |^*** | |   |  |                  | |^***||      | |  |   ||  |||              || ||     |              | ||                | || ^***| |         | || ||         | |         || ||  | |   | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  | ^***|    |||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||| | |  | |     |  | || |  |          | || |^**      ||| ||||||       |  || |  | |   |  |                  | ^**^**|      | |  |   ||  |||              || ||     |              ^**|                ^**| || || |         | || ||         | |         || ||  ^**   | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    ||^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||| | |  | |     |  | || |  |          | || | |       |^***|||||       |  || |  | |   |  |                  |  |  | |      | |  |   ||  |||              || ||     |              ^***                   ^*** || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    ||^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ||| | |  | |     |  | || |  |          | || | |       | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  |   ||  |||              || *******^                                       |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ||| | |  | |     |  | || |  |          | ^*****       | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  |   ||  |||              ||  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | ^*****| | | |       ^*****     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. ||| | |  | |     |  | || |  |          |  | |         | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  |   **********************|  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    |   |   | | | |        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  PEROXIDASE_1 .. ||| | |  | |     |  | || |  |          |  | |         | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  ********^**               |  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    |   |   | | | |        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||| | |  | |     |  | || |  |          |  | |         | | |*****       |  || |  | |   |  |                  |  |  | |      | |  |    |   |                |  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    |   |   | | | |        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ||| | |  | |     |  | || |  |          |  | |         | | |||||        |  || |  | |   |  |                  |  |  | |      | |  |    |   |                |  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    *****       | |         | |    |   |   | *****        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  asxturn .. *** | |  | |     |  ***| |  |          |  | |         | | |||||        |  |***  | |   |  |                  |  |  | |      ***  |    |   |                |  |                                             |  |***         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||                | |         | |    |   |   | ***          ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      ***     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |  | |     |  |  | ****          **** |         | | |****        |  |     | |   |  |                  |  |  | |        ****    |   |                |  |                                             |  || |         ******|         | |         ****|        | |      ||  |     ****      |  |****|                | |         | |    |   |   | |            ||| |     |  |  |  |       |   |     |  |  **** | |       ****     ||  | |              |  |  |  |    ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |  | |     |  |  | |             |  | |         | | ****         |  |     ***   |  |                  |  |  ***        |       |   |                |  |                                             |  || |            |  |         ***          |  |        ***      ||  |               |  |*** |                ***         ***    |   |   ***            ||| |     |  |  |  |       |   |     |  |  |  | ***       |  |     ||  | |              |  |  |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  ******  ***     ****  ***             **** |         ***              ****           ****                  ****             |       |   |                ****                                             *******            ****                      ****        ***      |****               **** ****                                   |   |                  |****     ****  ****       |   |     **********           ****     |******              ****  ****     ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                           | |                                                                                |       |   |                                                                                                                                   |   |                                                           *****                  | |                        |   |                                   |   | |                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           | |                                                                                |       *****                                                                                                                                   *****                                                                                  | |                        *****                                   ***** |                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           ***                                                                                |                                                                                                                                                                                                                                      ***                                                                    ***                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                              *                                                                                                                                                                                                                                                                                                                                                   

chain B : MYELOPEROXIDASE
member of: GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  SO4 2610D  ..                                                                                *                       
JMol viewer RasMol script viewer  CA 2600D  ..                                                                                |              *        
JMol viewer RasMol script viewer  HEM 605B  ..                                                                                |     *  **  * | ***    
JMol viewer RasMol script viewer  CYN 2844B  ..                                                                                |     |  |*  |*| |||    
JMol viewer RasMol script viewer  ACT 2611B  ..                *                                                               |     |  ||  ||| |||    
JMol viewer RasMol script viewer  SO4 2602B  ..                |                                                               |     |  ||  ||| |||    
JMol viewer RasMol script viewer  BR 2601B  ..                |             **                                                |     |  ||  ||| |||    
JMol viewer RasMol script viewer  ACT 1608B  ..               **  *        ||                                                |     |  ||  ||| |||    
JMol viewer RasMol script viewer  NAG 1641C  ..               || |  |        ||*                                               |     |  ||  ||| |||    
JMol viewer RasMol script viewer  MAN 1644C  ..               || |  |        |*|                                               |     |  ||  ||| |||    
JMol viewer RasMol script viewer  ACT 2608A  ..               || |  |        |||*                                              |     |  ||  ||| |||    
sec str:  ............................ee...............................hhhhhhhhhh..hhhhh.eeeeeehhhhhhhhhhhhhhh......
sequence :  ..CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |||| || | || |^**         | |||  | ||| ||   |            | |  |  |  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |^***** | || |  |         | |||  | ||| ^*****            | |  |  |  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | || |  | || |  |         | |||  | |||  |                | |  |  |  ***||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | || |  | || |  |         ****|  ****|  |                | |  ****  |  |****    | *****|      
search RasMol script viewer Motif-ligand binding stats  nest ..          ******  | || |  |           ***    ***  |                | |  |  |  |  |        |   |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                  *********                  ******                ***  ****  ****        |   ****      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                          *   *         

chain D : MYELOPEROXIDASE
member of: CATH:search1.10.640.10GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  BR 957D  ..                                                                                                                              *  *                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  BR 889D  ..                                                                                       **          **                         |  |                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  BR 758D  ..                                                                                       ||          ||                         |  |                                                                                                         *                                 *                                                                                                                                                                ***                                 
JMol viewer RasMol script viewer  ACT 2609D  ..                                                                                       ||          ||                         |  |                                                                                                         |                                 |                                                                                                                                                    **  **  *   |||                        *        
JMol viewer RasMol script viewer  ACT 2607D  ..                                                                                       ||          ||                         |  |                                                            *   *                                        |                                 |                                                                                                        **                                          ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 2604D  ..                                                                                       ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        ||                                 *  *     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 2606D  ..           *                                    *                                      ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        ||                                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 2610D  ..           |                                    |                                      ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        |* *                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CA 2600D  ..           |                                    |      * *   *                         ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        || |                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  FUC 2645D  ..           |                                    |      | |   |                         ||          ||                         |  |                                                            |   |            *                           |                                 |                                                                                                        || |             *                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2640D  ..           |                                    |      | |   |                         ||          ||                         |  |                                                            |   |         *  *                           |                                 |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2641D  ..           |                                    |      | |   |                         ||          ||                         |  |                                                            |   |         | *|                           |                                 |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2630D  ..           |                                    |      | |   |                         ||          ||           *  *          |  |                                                            |   |         | ||                           |                    *   *        |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2620D  ..           |                                    |      | |   |              *  *     **|*          ||           |  |          |  |                                                            |   |         | ||                           |                    |   |        |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  HEM 605B  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          *  **                                                           |   |         | ||        *  ** **           |                *   |   |        |                        *         *  *   *                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CYN 2844B  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         | ||        |  || ||           |                |   |   |        |                        |         |  |   |                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 2602B  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         | ||        |  || ||           |                |   |   |        |                      * |         |  |   |                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  BR 2601B  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         | ||     ** |  || ||           |                |   |   |        |                      | |         |  |   |           *                                                  || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 1608B  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         |**|     || |  || ||           |                |   |   |        |                      | |         |  |   |           |                                                  || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1640C  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         ||||     || |  || ||           |                |   |   |        |                      | |         |  |   |           |                                                  || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1641C  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         ||||     || |  || ||           |                |   |   |        |                      | |         |  |   |           |  * *                                             || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  BMA 1642C  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         ||||     || |  || ||           |                |   |   |        |                      | |         |  |   |           |  * |                                             || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  MAN 1644C  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |         ||||     || |  || ||           |                |   |   |        |                      | |         |  |   |           |  * |                                             || |             |*                |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  MAN 1643C  ..           |                                    |      | |   |              |  |     ||||          ||           |  |          |  ||                                                           |   |*        ||||     || |  || ||           |                |   |   |        |                      | |         |  |   |           |  | |                                             || |             ||                |  |     ||  ||  |   |||                        |        
sec str:  .................ee.............ee...................ee.......hhhhhh.hhhhhhhh...............................hhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhh..eee.............eee.hhh...hhhhhhh..hhhhhhhhhh.eee........hhhhhh..hhhhh....hhhhhhhhhhhhh...hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...........hhhhhhhhh..hhhhhhhhhh...eee.............eee.hhh....hhhhh..
sequence :  ..VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
seq num:  ..113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||  | |  | |        | || |  |          | ||^***|      ||| ||||||     | ||||^*** | |   |  |                 |  |^***||        || ||| |||||||     |   |    || |||   ||          |   | ||                | || ^***| |   |  || | || ||       | |||         | ||| || |   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  | ^***|   ||||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||  | |  | |        | || |  |          | || |^**      ||| ||||||     | ||||| |  | |   |  |                 |  ^**^**|        || ||| |||||||     |   |    || |||   ||          |   ^**|                ^**| || || |   |  || | || ||       | |||         | ||| |^**   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   |||^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||  | |  | |        | || |  |          | || |||       |^***|||||     | ||||| |  | |   |  |                 |  |   | |        || ||| |||||||     |   |    || |||   ||          |   ^***                   ^*** || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   |||^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ||  | |  | |        | || |  |          | || |||       | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ||| |||||||     |   |    || *******^          |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ||  | |  | |        | || |  |          | ^*****       | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ||| |||||||     |   |    ||  ||   |           |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    | ^*****| |   |      |^*****     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. ||  | |  | |        | || |  |          |  | ||        | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ||| **********************|  ||   |           |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    |   |   | |   |      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  PEROXIDASE_1 .. ||  | |  | |        | || |  |          |  | ||        | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ********^**     |   |     |  ||   |           |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    |   |   | |   |      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||  | |  | |        | || |  |          |  | ||        | | |*****     *****|| |  | |   |  |                 |  |   | |        || ||| *****|      |   |     |  ||   |           |   |                        |  || |   ***** | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    |   |   | |   |      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      *****   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ***** |  | |        | || |  |          |  | ||        | | |||||      | || || |  | |   |  |                 |  |   | |        || ||| |||| |      |   |     |  |*****           |   |                        |  || |   |  |  | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      *****       | |         | |    |   |   | *****      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      *****   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |  | |        ***| |  |          |  | ||        | | |||||      | || |***  | |   |  |                 |  |   | |        || ||| |||| |      |   |     |  |                |   |                        |  || |   |  |  | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |                  | |         | |    |   |   | |          | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      ***|    |  |  |  |   *** ||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  | |  | |           | |  |          |  | ||        | | |||||      | || |     | |   |  |                 |  |   | |        || ||| |||| |      |   |     |  |                |   |                        |  || |   |  |  | || ||       *****         | ||| |  |   | |       |  |     |  |      |  || |                  | |         | |    |   |   | |          | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      |  |    |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |  | |           | |  |          |  | ||        | | |****      **** |     | |   |  |                 ****   | |        ****|| **** |      |   |     |  |                |   |                        |  || |   ****  ******|       ****|         **********   | |       |  |     ****      |  || |                  | |         | |    |   |   | |          | ||| |     |  |  |  |                 |  |  **** | ||   |  ****     ||  | |      ****    |  |  |  |    ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |  | |           | |  |          |  | ||        | | ****         |  |     ***   |  |                        ***        ||  ||  ||  |      |   |     |  |                |   |                        |  || |            |  |         ***           | |        ***       |  |               |  |***                  ***         ***    |   |   ***          ***|| |     |  |  |  |                 |  |  |  | ***|   |  |  |     ||  | |              |  |  |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  ******  ***           ******          *******        ***              ****           ****                                   |****|  ||  |      |   |     ****                |   |                        *******            ****                       ***        ***       ****               ****                                        |   |                  |****     ****  ****                 **********    |   |  ****     |******              ****  ****     ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..     | |                                   | |                                                                                |    |  ||  |      |   |                         |   |                                                                                                                                                          *****                  | |                                                *****           |   |                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..     | |                                   | |                                                                                |    ********      *****                         *****                                                                                                                                                                                 | |                                                                *****                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                   ***                                                                                |                                                                                                                                                                                                                                      ***                                                                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                              *                                                                                                                                                                                                                                                                                                                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain B : MYELOPEROXIDASE
member of: GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  SO4 2610D  ..                                                                                *                       
JMol viewer RasMol script viewer  CA 2600D  ..                                                                                |              *        
JMol viewer RasMol script viewer  HEM 605B  ..                                                                                |     *  **  * | ***    
JMol viewer RasMol script viewer  CYN 2844B  ..                                                                                |     |  |*  |*| |||    
JMol viewer RasMol script viewer  ACT 2611B  ..                *                                                               |     |  ||  ||| |||    
JMol viewer RasMol script viewer  SO4 2602B  ..                |                                                       *       |     |  ||  ||| |||    
JMol viewer RasMol script viewer  BR 2601B  ..                |             **                                        |       |     |  ||  ||| |||    
JMol viewer RasMol script viewer  ACT 1608B  ..               **  *        ||                                        |       |     |  ||  ||| |||    
sec str:  ............................ee...............................hhhhhhhhhh..hhhhh.eeeeeehhhhhhhhhhhhhhh......
sequence :  ..CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          |||| || | || |^**         | |||  | ||| ||   |            | |  |  |  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |^***** | || |  |         | |||  | ||| ^*****            | |  |  |  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  asxturn ..          | || |  | || |  |         | |||  | |||  |                | |  |  |  ***||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          | || |  | || |  |         ****|  ****|  |                | |  ****  |  |****    | *****|      
search RasMol script viewer Motif-ligand binding stats  nest ..          ******  | || |  |           ***    ***  |                | |  |  |  |  |        |   |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..                  *********                  ******                ***  ****  ****        |   ****      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                          *   *         

chain D : MYELOPEROXIDASE
member of: CATH:search1.10.640.10GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  BR 957D  ..                                                                                                                              *  *                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  BR 889D  ..                                                                                       **          **                         |  |                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  BR 758D  ..                                                                                       ||          ||                         |  |                                                                                                         *                                 *                                                                                                                                                                ***                                 
JMol viewer RasMol script viewer  ACT 2609D  ..                                                                                       ||          ||                         |  |                                                                                                         |                                 |                                                                                                                                                    **  **  *   |||                        *        
JMol viewer RasMol script viewer  ACT 2607D  ..                                                                                       ||          ||                         |  |                                                            *   *                                        |                                 |                                                                                                        **                                          ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 2604D  ..                                                                                       ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        ||                                 *  *     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 2606D  ..           *                                    *                                      ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        ||                                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 2610D  ..           |                                    |                                      ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        |* *                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CA 2600D  ..           |                                    |      * * * *                         ||          ||                         |  |                                                            |   |                                        |                                 |                                                                                                        || |                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  FUC 2645D  ..           |                                    |      | | | |                         ||          ||                         |  |                                                            |   |            *                           |                                 |                                                                                                        || |             *                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2640D  ..           |                                    |      | | | |                         ||          ||                         |  |                                                            |   |         *  *                           |                                 |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2641D  ..           |                                    |      | | | |                         ||          ||                         |  |                                                            |   |         | *|                           |                                 |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2630D  ..           |                                    |      | | | |                         ||          ||           *  *          |  |                                                            |   |         | ||                           |                    *   *        |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 2620D  ..           |                                    |      | | | |              *  *     **|*          ||           |  |          |  |                                                            |   |         | ||                           |                    |   |        |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  HEM 605B  ..           |                                    |      | | | |              |  |     ||||          ||           |  |          *  **                                                           |   |         | ||        *  ** **           |                *   |   |        |                        *         *  *   *                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CYN 2844B  ..           |                                    |      | | | |              |  |     ||||          ||           |  |          |  ||                                                           |   |         | ||        |  || ||           |                |   |   |        |                        |         |  |   |                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 2602B  ..           |                                    |      | | | |              |  |     ||||          ||           |  |          |  ||                                                           |   |         | ||        |  || ||           |                |   |   |        |                      * |         |  |   |                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  BR 2601B  ..           |                                    |      | | | |              |  |     ||||          ||           |  |          |  ||                                                           |   |         | ||     ** |  || ||           |                |   |   |        |                      | |         |  |   |           *                                                  || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 1608B  ..           |                                    |      | | | |              |  |     ||||          ||           |  |          |  ||                                                           |   |         |**|     || |  || ||           |                |   |   |        |                      | |         |  |   |           |                                                  || |             |                 |  |     ||  ||  |   |||                        |        
sec str:  .................ee.............ee...................ee.......hhhhhh.hhhhhhhh...............................hhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhh..eee.............eee.hhh...hhhhhhh..hhhhhhhhhh.eee........hhhhhh..hhhhh....hhhhhhhhhhhhh...hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...........hhhhhhhhh..hhhhhhhhhh...eee.............eee.hhh....hhhhh..
sequence :  ..VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
seq num:  ..113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||  | |  | |        | || |  |          | ||^***|      ||| ||||||     | ||||^*** | |   |  |                 |  |^***||        || ||| |||||||     |   |    || |||   ||          |   | ||                | || ^***| |   |  || | || ||       | |||         | ||| || |   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  | ^***|   ||||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||  | |  | |        | || |  |          | || |^**      ||| ||||||     | ||||| |  | |   |  |                 |  ^**^**|        || ||| |||||||     |   |    || |||   ||          |   ^**|                ^**| || || |   |  || | || ||       | |||         | ||| |^**   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   |||^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||  | |  | |        | || |  |          | || |||       |^***|||||     | ||||| |  | |   |  |                 |  |   | |        || ||| |||||||     |   |    || |||   ||          |   ^***                   ^*** || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   |||^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ||  | |  | |        | || |  |          | || |||       | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ||| |||||||     |   |    || *******^          |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    | | |  || |   |      ||||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ||  | |  | |        | || |  |          | ^*****       | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ||| |||||||     |   |    ||  ||   |           |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    | ^*****| |   |      |^*****     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. ||  | |  | |        | || |  |          |  | ||        | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ||| **********************|  ||   |           |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    |   |   | |   |      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  PEROXIDASE_1 .. ||  | |  | |        | || |  |          |  | ||        | | ||||||     | ||||| |  | |   |  |                 |  |   | |        || ********^**     |   |     |  ||   |           |   |                        |  || |   |  || | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    |   |   | |   |      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      | |||   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||  | |  | |        | || |  |          |  | ||        | | |*****     *****|| |  | |   |  |                 |  |   | |        || ||| *****|      |   |     |  ||   |           |   |                        |  || |   ***** | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      |   |       | |         | |    |   |   | |   |      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      *****   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ***** |  | |        | || |  |          |  | ||        | | |||||      | || || |  | |   |  |                 |  |   | |        || ||| |||| |      |   |     |  |*****           |   |                        |  || |   |  |  | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |      *****       | |         | |    |   |   | *****      | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      *****   |  |  |  |   ||| ||  
search RasMol script viewer Motif-ligand binding stats  asxturn ..  |  | |  | |        ***| |  |          |  | ||        | | |||||      | || |***  | |   |  |                 |  |   | |        || ||| |||| |      |   |     |  |                |   |                        |  || |   |  |  | || ||       | |||         | ||| |  |   | |       |  |     |  |      |  || |                  | |         | |    |   |   | |          | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      ***|    |  |  |  |   *** ||  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..  |  | |  | |           | |  |          |  | ||        | | |||||      | || |     | |   |  |                 |  |   | |        || ||| |||| |      |   |     |  |                |   |                        |  || |   |  |  | || ||       *****         | ||| |  |   | |       |  |     |  |      |  || |                  | |         | |    |   |   | |          | ||| |     |  |  |  |                 |  |  |  | | ||   |  |  |     ||  | |      |  |    |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |  | |           | |  |          |  | ||        | | |****      **** |     | |   |  |                 ****   | |        ****|| **** |      |   |     |  |                |   |                        |  || |   ****  ******|       ****|         **********   | |       |  |     ****      |  || |                  | |         | |    |   |   | |          | ||| |     |  |  |  |                 |  |  **** | ||   |  ****     ||  | |      ****    |  |  |  |    ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |  | |           | |  |          |  | ||        | | ****         |  |     ***   |  |                        ***        ||  ||  ||  |      |   |     |  |                |   |                        |  || |            |  |         ***           | |        ***       |  |               |  |***                  ***         ***    |   |   ***          ***|| |     |  |  |  |                 |  |  |  | ***|   |  |  |     ||  | |              |  |  |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  ******  ***           ******          *******        ***              ****           ****                                   |****|  ||  |      |   |     ****                |   |                        *******            ****                       ***        ***       ****               ****                                        |   |                  |****     ****  ****                 **********    |   |  ****     |******              ****  ****     ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..     | |                                   | |                                                                                |    |  ||  |      |   |                         |   |                                                                                                                                                          *****                  | |                                                *****           |   |                                     
search RasMol script viewer Motif-ligand binding stats  ststaple ..     | |                                   | |                                                                                |    ********      *****                         *****                                                                                                                                                                                 | |                                                                *****                                     
search RasMol script viewer Motif-ligand binding stats  stturn ..     ***                                   ***                                                                                |                                                                                                                                                                                                                                      ***                                                                                                          
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                              *                                                                                                                                                                                                                                                                                                                                                   

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : MYELOPEROXIDASE
member of: GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  SO4 1610C  ..                                                                                *                       
JMol viewer RasMol script viewer  CA 1600C  ..                                                                                |              *        
JMol viewer RasMol script viewer  HEM 605A  ..                                                                                |     *  **  * | ***    
JMol viewer RasMol script viewer  ACT 2608A  ..               *  *  *                                                          |     |  ||  | | |||    
JMol viewer RasMol script viewer  CYN 1844A  ..               |  |  |                                                          |     |  |*  |*| |||    
JMol viewer RasMol script viewer  BR 1601A  ..               |  |  |        **                                                |     |  ||  ||| |||    
sec str:  ............................ee...............................hhhhhhhhhh..hhhhh.eeeeeehhhhhhhhhhhhhhh......
sequence :  ..CPEQDKYRTITGMCNNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTDQLTPDQERSLMFMQWGQLLDHDLDFTPEPA
seq num:  ..1         11        21        31        41        51        61        71        81        91        101 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..          ||||||| | || |^**           | |  | ||| ||   |           |  | || ||  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          |^***** | || |  |           | |  | ||| ^*****           |  | || ||  | |||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          ||||||  | || |  |           | |  | |||  |               |  | || ||  | |||  |    | ******      
search RasMol script viewer Motif-ligand binding stats  asxturn ..          ||||||  | || |  |           ***  | |||  |               |  | || ||  ***||  |    | ||||||      
search RasMol script viewer Motif-ligand binding stats  betaturn ..          |****|  | || |  |           | |  ****|  |               |  | ****|  |  |****    | *****|      
search RasMol script viewer Motif-ligand binding stats  nest ..          ******  | || |  |           ***    ***  |               |  |  |  |  |  |        |   |  |      
search RasMol script viewer Motif-ligand binding stats  niche ..             ***  *********                  ******               ****  ****  ****        |   ****      
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                          *   *         

chain C : MYELOPEROXIDASE
member of: CATH:search1.10.640.10GENE3D:searchG3DSA_1.10.640.10PANTHER:searchPTHR11475/searchPTHR11475_SF46PFAM:searchPF03098PRINTS:searchANPEROXIDASEPROSITE PROFILES:searchPS50292, SUPERFAMILY:searchSSF48113UniProt:searchP05164
JMol viewer RasMol script viewer  BR 957C  ..                                                                                                                              *  *                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  BR 889C  ..                                                                                       **          **                         |  |                                                                                                                                                                                                                                                                                                                                                
JMol viewer RasMol script viewer  BR 758C  ..                                                                                       ||          ||                         |  |                                                                                                         *                                 *                                                                                                                                                                ***                                 
JMol viewer RasMol script viewer  ACT 1612C  ..                                                                                       ||          ||                         |  |                                                                                                         |                                 |                                                                                                                                                                |||                                 
JMol viewer RasMol script viewer  ACT 1609C  ..                                                                                       ||          ||                         |  |                                            *                                                            |                                 |                                                                                                                                                    **  **  *   |||                        *        
JMol viewer RasMol script viewer  ACT 1607C  ..                                                                                       ||          ||                         |  |                                            |               *   *                                        |                                 |                                                                                                        *                                           ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 1604C  ..                                                                                       ||          ||                         |  |                                            |               |   |                                        |                                 |                                                                                                        |                                  *  *     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 1606C  ..          **                       *            *                                      ||          ||                         |  |                                            |               |   |                                        |                                 |                                                                                                        |                                  |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 1610C  ..          ||                       |            |                                      ||          ||                         |  |                                            |               |   |                                        |                                 |                                                                                                        |* *                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  SO4 1603C  ..          ||                       |            |                                      ||          ||               *         |  |                                            |               |   |                                        |                                 |                                                                                                        || |                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CA 1600C  ..          ||                       |            |      * * * *                         ||          ||               |         |  |                                            |               |   |                                        |                                 |                                                                                                        || |                               |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  FUC 1645C  ..          ||                       |            |      | | | |                         ||          ||               |         |  |                                            |               |   |            *                           |                                 |                                                                                                        || |             *                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1640C  ..          ||                       |            |      | | | |                         ||          ||               |         |  |                                            |               |   |         *  *                           |                                 |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1641C  ..          ||                       |            |      | | | |                         ||          ||               |         |  |                                            |               |   |         | *|                           |                                 |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1630C  ..          ||                       |            |      | | | |                         ||          ||           *  *|         |  |                                            |               |   |         | ||                           |                    *   *        |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  NAG 1620C  ..          ||                       |            |      | | | |              *  *   * **|*          ||           |  ||         |  |                                            |               |   |         | ||                           |                    |   |        |                                                                                                        || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  HEM 605A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         *  **                                           |               |   |         | ||        *  ** **  *        |                *   |   |        |                       **         *      *                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  ACT 2608A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   |         |***        |  || ||  |        |                |   |   |        |                       ||         |      |                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  CYN 1844A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   |         ||||        |  || ||  |        |                |   |   |        |                       ||         |      |                                                              || |             |                 |  |     ||  ||  |   |||                        |        
JMol viewer RasMol script viewer  BR 1601A  ..          ||                       |            |      | | | |              |  |   | ||||          ||           |  ||         |  ||                                           |               |   |         ||||     ** |  || ||  |        |                |   |   |        |                       ||         |      |     *     *                                                  || |             |                 |  |     ||  ||  |   |||                        |        
sec str:  .................ee.............ee...................ee.......hhhhhh.hhhhhhhhh..............................hhhhhhh.................hhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhh..eee.............eee.hhh...hhhhhhh..hhhhhhhhhhheee........hhhhhh..hhhhh....hhhhhhhhhhhhh...hhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh...........hhhhhhhhh..hhhhhhhhhh...eee.............eee.hhh....hhhhh..
sequence :  ..VNCETSCVQQPPCFPLKIPPNDPRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQLGLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLLREHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYRSYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLEGGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREA
seq num:  ..113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433       443       453       463       473       483       493       503       513       523       533       543       553       563       573   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. ||| | |  | |     |  | || |  |          | ||^***|      ||| ||||||       |  |^*** | |   |  |                  | |^***||      | |  |   ||  |||              || ||     |              | ||                | || ^***| |         | || ||         | |         || ||  | |   | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  | ^***|    |||||| 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. ||| | |  | |     |  | || |  |          | || |^**      ||| ||||||       |  || |  | |   |  |                  | ^**^**|      | |  |   ||  |||              || ||     |              ^**|                ^**| || || |         | || ||         | |         || ||  ^**   | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    ||^**| 
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. ||| | |  | |     |  | || |  |          | || | |       |^***|||||       |  || |  | |   |  |                  |  |  | |      | |  |   ||  |||              || ||     |              ^***                   ^*** || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    ||^*** 
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. ||| | |  | |     |  | || |  |          | || | |       | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  |   ||  |||              || *******^                                       |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | | |  || | | |       |||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. ||| | |  | |     |  | || |  |          | ^*****       | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  |   ||  |||              ||  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    | ^*****| | | |       ^*****     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER .. ||| | |  | |     |  | || |  |          |  | |         | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  |   **********************|  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    |   |   | | | |        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  PEROXIDASE_1 .. ||| | |  | |     |  | || |  |          |  | |         | | ||||||       |  || |  | |   |  |                  |  |  | |      | |  ********^**               |  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    |   |   | | | |        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. ||| | |  | |     |  | || |  |          |  | |         | | |*****       |  || |  | |   |  |                  |  |  | |      | |  |    |   |                |  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    |   |       | |         | |    |   |   | | | |        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  asxmotif .. ||| | |  | |     |  | || |  |          |  | |         | | |||||        |  || |  | |   |  |                  |  |  | |      | |  |    |   |                |  |                                             |  || |         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||    *****       | |         | |    |   |   | *****        ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      | |     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  asxturn .. *** | |  | |     |  ***| |  |          |  | |         | | |||||        |  |***  | |   |  |                  |  |  | |      ***  |    |   |                |  |                                             |  |***         | || ||         | |         || ||        | |      ||  |     |  |      |  ||||||                | |         | |    |   |   | ***          ||| |     |  |  |  |       |   |     |  |  |  | | |       |  |     ||  | |      ***     |  |  |  |    || ||  
search RasMol script viewer Motif-ligand binding stats  betaturn ..  |  | |  | |     |  |  | ****          **** |         | | |****        |  |     | |   |  |                  |  |  | |        ****    |   |                |  |                                             |  || |         ******|         | |         ****|        | |      ||  |     ****      |  |****|                | |         | |    |   |   | |            ||| |     |  |  |  |       |   |     |  |  **** | |       ****     ||  | |              |  |  |  |    ****|  
search RasMol script viewer Motif-ligand binding stats  nest ..  |  | |  | |     |  |  | |             |  | |         | | ****         |  |     ***   |  |                  |  |  ***        |       |   |                |  |                                             |  || |            |  |         ***          |  |        ***      ||  |               |  |*** |                ***         ***    |   |   ***            ||| |     |  |  |  |       |   |     |  |  |  | ***       |  |     ||  | |              |  |  |  |     |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..  ******  ***     ****  ***             **** |         ***              ****           ****                  ****             |       |   |                ****                                             *******            ****                      ****        ***      |****               **** ****                                   |   |                  |****     ****  ****       |   |     **********           ****     |******              ****  ****     ****  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                           | |                                                                                |       |   |                                                                                                                                   |   |                                                           *****                  | |                        |   |                                   |   | |                                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                           | |                                                                                |       *****                                                                                                                                   *****                                                                                  | |                        *****                                   ***** |                                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                           ***                                                                                |                                                                                                                                                                                                                                      ***                                                                    ***                                   
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                              *                                                                                                                                                                                                                                                                                                                                                   

   New search    1d7w:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors