triangle PDBeMotif: 1cmo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription    | release date: Tue, May 11, 1999
Title immunoglobulin motif dna-recognition and heterodimerization for the pebp2/cbf runt-domain
Authors A.SALI, B.T.CHAIT, D.SORCE, K.SHIGESADA, M.H.WERNER, T.NAGATA, V.GUPTA, W.Y.KIM, Y.ITO
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARF
NDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |  | | ||  |  |^***         | |  |    |  ||  ^***   ^***   | |   | |   ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |  | | ||  |  ^**           | |  |    |  ||  ||     | |    | |   | |   ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |  | | ||  |                | |  ^*****  ^*****     | |    | |   | |   || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |  | | ||  |                | |           |  |      | |    | |   | |   ********                                 
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |  | | ||  |                | |           |  |      | |    ***   | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |  | | ||  |                | |           ****      | |          | |    | ****                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |  | | ||  |                ***           |  |      | |          | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..             | |  | | ||  |                              |  |      ***          | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..             ****** *******                              ****                   ***    ******                                  

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |  | | | |    |^***           | ||    |  ||  ^***   ^***         | |   ||||| ||                        | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |  | | | |    ^**             | ||    |  ||  ||     | |          | |   ||^** ||                        | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |  | | | |                    | |^*****  ^*****     | |          | |   || |  ||                        | |      
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |  | | | |                    | |         |  |      | |          | |   ********                        | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |  | | | |                    | |         |  |      | |          | |    | ****                         | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |  | | | |                    | |         |  |      | |          ***    | |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  | | | |                    | |         |  |      ***                 | |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  niche ..****         ****** *****                    ***         ****                          ******                         ***      

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |          | |    | |      |^***           | ||    |  ||  ^***   ^***         ||||  | ||| ||                             | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |          | |    | |      ^** |           | ||    |  ||  ||     | |          ||||  | ^** ||                             | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |          | |    | |        | |           | |^*****  ^*****     | |          ||||  |  |  ||                             | | 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..| |          | |    | |        | |           | |         |  |      | |          ||||  ********                             | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***          | |    | |        ***           | |         |  |      | |          ****     |  |                              *** 
search RasMol script viewer Motif-ligand binding stats  nest ..             | |    | |                      | |         |  |      ***                   |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..             ***    ***                      ***         ****                            ****                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                               

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..   | |       | |             |^***           | ||    |  ||  ^***   ^***         | |   |||||  |                             |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   | |       | |             ^**             | ||    |  ||  ||     | |          | |   ||^**  |                             |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   | |       | |                             | |^*****  ^*****     | |          | |   || |   |                             |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..   | |       | |                             | |         |  |      | |          | |   ********                             |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..   | |       | |                             | |         ****      | |          | |    | |                                 ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..   | |       | |                             | |         |  |      | |          ***    | |                                     
search RasMol script viewer Motif-ligand binding stats  nest ..   | |       | |                             | |         |  |      ***                 | |                                     
search RasMol script viewer Motif-ligand binding stats  niche ..   ***       ***                             ***         ****                          ***                                     

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |  | | ||  |  |^***           | ||    |  ||  ^***   ^***   | |   | |   ||||| ||                    | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |  | | ||  |  ^**             | ||    |  ||  ||     | |    | |   | |   ||^** ||                    | |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |  | | ||  |                  | |^*****  ^*****     | |    | |   | |   || |  ||                    | |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |  | | ||  |                  | |         |  |      | |    | |   | |   ********                    | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |  | | ||  |                  | |         |  |      | |    ***   | |    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |  | | ||  |                  | |         |  |      | |          | |    | ****                     | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |  | | ||  |                  | |         |  |      | |          ***    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..             | |  | | ||  |                  | |         |  |      ***                 | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..             ****** *******                  ***         ****                          ******                     ***          

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |             |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                    | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |             ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                    | |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |                             | |^*****  ^*****     | |          ||||  || |  ||                    | |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |                             | |         |  |      | |          ||||  ********                    | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |                             | |         |  |      | |          |***   | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..             | |                             | |         |  |      ***          | |    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..             ***                             ***         ****                   ***    ******                     ***          
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                               

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |    | |      |^***           | ||    |  || |^***   ^***         | |   ||||| ||                    | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |    | |      ^**             | ||    |  || |||     | |          | |   ||^** ||                    | |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |    | |                      | |^*****  ^*****     | |          | |   || |  ||                    | |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |    | |                      | |         | ||      | |          | |   ********                    | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |         | |    | |                      | |         ***|      | |          | |    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |    | |                      | |         |  |      | |          ***    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | |                      | |         |  |      ***                 | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    ***                      ***         ****                          ******                     ***          

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |             |^***           | ||    |  || |^***   ^***               ||||| ||                    | |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |             ^**             | ||    |  || |||     | |                ||^** ||                    | |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |             | |             | |^*****  ^*****     | |                || |  ||                    | |          
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |             | |             | |         | ||      | |                ********                    | |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..             | |             | |             | |         ***|      | |                 | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |             | |             | |         |  |      | |                 | ****                     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..             | |             | |             | |         |  |      ***                 | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..             ***             | |             ***         ****                          ******                     ***          
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***             ***                                                                                               

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |  | ||||||| ||^***       | |    |    |  ||  ^***   ^***         ||||  ||||| ||                    | |    | | | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |  | ||||||| |^** |       | |    |    |  ||  ||     | |          ||||  ||^** ||                    | |    | | | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |  | ||||||| | || |       | |    ^*****  ^*****     | |          ||||  || |  ||                    | |    | | | 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |  | ||||||| | || |       | |             |  |      | |          ||||  ********                    | |    | | | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |  | ||||||| | || |       | |             |  |      | |          ||||   | ****                     | |    | | | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |  | |*****| ******       | |             |  |      | |          |***   | |  |                     | |    ***** 
search RasMol script viewer Motif-ligand binding stats  nest ..             | |  | | | | |              | |             |  |      ***          | |    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..             ****** *** ***              ***             ****                   ***    ******                     ***          

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |          | |             |^***           | ||    |  ||  ^***   ^***   | |   ||||  ||||| ||                    | | | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| |          | |             ^**             | ||    |  ||  ||     | |    | |   ||||  ||^** ||                    | | | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| |          | |                             | |^*****  ^*****     | |    | |   ||||  || |  ||                    | | | |      
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..| |          | |                             | |         |  |      | |    | |   ||||  ********                    | | | |      
search RasMol script viewer Motif-ligand binding stats  asxturn ..| |          | |                             | |         |  |      | |    ***   ||||   | |  |                     | | | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***          | |                             | |         |  |      | |          |***   | |  |                     | | | |      
search RasMol script viewer Motif-ligand binding stats  nest ..             | |                             | |         |  |      ***          | |    | |  |                     | | | |      
search RasMol script viewer Motif-ligand binding stats  niche ..             ***                             ***         ****                   ***    ******                     *** ***      

11     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |             |^***       | |    |    |  |   ^***   ^***         ||||  ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |             ^**         | |    |    |  |    |     | |          ||||  ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |                         | |    ^*****  ^*****     | |          ||||  || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |                         | |                       | |          ||||  ********                                 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |                         | |                       | |          |***   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |                         | |                       ***          | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***                         ***                                    ***    ******                                  

12     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |       | |   |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |       | |   ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |       | |                   | |^*****  ^*****     | |          ||||  || || ||                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |       | |                   | |         |  |      | |          ||||  ********                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |       | |                   | |         |  |      | |          ||||   | || |                     | |      ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |       ***                   | |         |  |      | |          ****   | |***                     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..             | |                             | |         |  |      ***                 | |                        | |          
search RasMol script viewer Motif-ligand binding stats  niche ..             ***                             ***         ****                          ***                        ***          

13     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |    | || |   |^***           | ||    |  ||  ^***   ^***          | |  | ||| ||                        | | |  | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |    | || |   ^**             | ||    |  ||  ||     | |           | |  | ^** ||                        | | |  | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |    | || |                   | |^*****  ^*****     | |           | |  |  |  ||                        | | |  | 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |    | || |                   | |         |  |      | |           | |  ********                        | | |  | 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |    | || |                   | |         |  |      | |           | |     |  |                         | | **** 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |    | |***                   | |         |  |      | |           ***     |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | |                      | |         |  |      ***                   |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    ***                      ***         ****                            ****                         ***      

14     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |  |   | |    |^***              |    |  ||  ^***   ^***          | |  ||||| ||                       | | | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |  |   | |    ^**                |    |  ||  ||     | |           | |  ||^** ||                       | | | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |  |   | |                       ^*****  ^*****     | |           | |  || |  ||                       | | | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |  |   | |                                |  |      | |           | |  ********                       | | | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |  |   | |                                |  |      | |           | |   | ****                        | | | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |  |   | |                                |  |      | |           ***   | |  |                        *** | |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  |   | |                                |  |      ***                 | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  niche ..****         ******   ***                                ****                          ******                            ***   

15     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. || ||       | |    | | |    |^***              |    |  ||  ^***   ^***   | |   ||||  ||||| ||                          |||| | 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. || ||       | |    | | |    ^**                |    |  ||  ||     | |    | |   ||||  ||^** ||                          |||| | 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. || ||       | |    | | |                       ^*****  ^*****     | |    | |   ||||  || |  ||                          |||| | 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A .. || ||       | |    | | |                                |  |      | |    | |   ||||  ********                          |||| | 
search RasMol script viewer Motif-ligand binding stats  asxturn .. || ||       | |    | | |                                |  |      | |    ***   ||||   | |  |                           |||| | 
search RasMol script viewer Motif-ligand binding stats  betaturn .. ****|       | |    | | |                                ****      | |          ||||   | |  |                           |||| | 
search RasMol script viewer Motif-ligand binding stats  gammaturn ..  |  |       | |    | | |                                          | |          |***   | |  |                           ****** 
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |       | |    | | |                                          ***          | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..  ****       ***    *****                                                       ***    ******                                  

16     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |    | |       | |   |^***              |    |  ||  ^***   ^***         ||||  | ||| ||                    | | | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |    | |       | |   ^**                |    |  ||  ||     | |          ||||  | ^** ||                    | | | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |    | |       | |                      ^*****  ^*****     | |          ||||  |  |  ||                    | | | |      
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..     |  |    | |       | |                               |  |      | |          ||||  ********                    | | | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |    | |       ***                               |  |      | |          |***     |  |                     | | | |      
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |    | |                                         |  |      ***          | |      |  |                     | | | |      
search RasMol script viewer Motif-ligand binding stats  niche ..     ****    ***                                         ****                   ***      ****                     *** ***      

17     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | |    | |  |    | |   |^***              |    |  ||  ^***   ^***         ||||  ||||| ||                           | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | |    | |  |    | |   ^** |              |    |  ||  ||     | |          ||||  ||^** ||                           | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |    | |  |    | |     | |              ^*****  ^*****     | |          ||||  || |  ||                           | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |  | |    | |  |    | |     | |                       |  |      | |          ||||  ********                           | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |  | |    | |  |    | |     | |                       ****      | |          ||||   | ****                            | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  ***    | |  |    ***     ***                       |  |      | |          |***   | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  |                                      |  |      ***          | |    | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  niche ..****         ******                                      ****                   ***    ******                            ***   

18     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | |    | |  | | |      |^***              |    |  |   ^***   ^***         ||||  ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | |    | |  | | |      ^**                |    |  |    |     | |          ||||  ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |    | |  | | |                         ^*****  ^*****     | |          ||||  || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |  | |    | |  | | |                                            | |          ||||  ********                                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |  | |    | |  | | |                                            | |          ||||   | ****                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  ***    | |  | | |                                            | |          |***   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  | | |                                            ***          | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ****** ***                                                         ***    ******                                  

19     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |  | | | |    |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                             |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |  | | | |    ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                             |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |  | | | |                    | |^*****  ^*****     | |          ||||  || |  ||                             |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |  | | | |                    | |         |  |      | |          ||||  ********                             |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |  | | | |                    | |         ****      | |          ||||   | |  |                              ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |  | | | |                    | |         |  |      | |          ****   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  | | | |                    | |         |  |      ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ****** *****                    ***         ****                          ******                                  

20     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |    | | |    |^***           | ||    |  ||  ^***   ^***         | |   ||||| ||                           | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |    | | |    ^**             | ||    |  ||  ||     | |          | |   ||^** ||                           | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |    | | |                    | |^*****  ^*****     | |          | |   || |  ||                           | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |    | | |                    | |         |  |      | |          | |   ********                           | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | |    | | |                    | |         ****      | |          | |    | ****                            | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |    | | |                    | |         |  |      | |          ***    | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  nest ..             | |    | | |                    | |         |  |      ***                 | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  niche ..             ***    *****                    ***         ****                          ******                            ***   
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                               

21     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | | |     | |  |    | |   |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                        | || |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | | |     | |  |    | |   ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                        | || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  | | |     | |  |    | |                   | |^*****  ^*****     | |          ||||  || |  ||                        | || |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  | | |     | |  |    | |                   | |         |  |      | |          ||||  ********                        | || |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  | | |     | |  |    | |                   | |         ****      | |          ||||   | |  |                         | || |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  | | |     | |  |    ***                   | |         |  |      | |          |***   | |  |                         | || |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  | | |     | |  |                          | |         |  |      ***          | |    | |  |                         | || |   
search RasMol script viewer Motif-ligand binding stats  niche ..**** ***     ******                          ***         ****                   ***    ******                         ******   

22     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | |    | |             |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | |    | |             ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |    | |                             | |^*****  ^*****     | |          ||||  || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |  | |    | |                             | |         |  |      | |          ||||  ********                                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |  | |    | |                             | |         ****      | |          ||||   | ****                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  ***    | |                             | |         |  |      | |          |***   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |                             | |         |  |      ***          | |    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***                             ***         ****                   ***    ******                                  

23     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |    | |      |^***       | |    |    |  |   ^***   ^***         ||||  |||||  |                        | || |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |    | |      ^**         | |    |    |  |    |     | |          ||||  ||^**  |                        | || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |    | |                  | |    ^*****  ^*****     | |          ||||  || |   |                        | || |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |    | |                  | |                       | |          ||||  ********                        | || |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |    | |                  | |                       | |          |***   | |                            | || |   
search RasMol script viewer Motif-ligand binding stats  nest ..             | |    | |                  | |                       ***          | |    | |                            | || |   
search RasMol script viewer Motif-ligand binding stats  niche ..             ***    ***                  ***                                    ***    ***                            ******   

24     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |  | |||||||  |^***           | ||    |  ||  ^***   ^***         | |   ||||| ||                    | |    | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |  | |||||||  ^**             | ||    |  ||  ||     | |          | |   ||^** ||                    | |    | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |  | |||||||                  | |^*****  ^*****     | |          | |   || |  ||                    | |    | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |  | |||||||                  | |         |  |      | |          | |   ********                    | |    | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |  | |||||||                  | |         ****      | |          | |    | |  |                     | |    | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |  | |*****|                  | |                   | |          ***    | |  |                     | |    | |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  | | | | |                  | |                   ***                 | |  |                     | |    | |   
search RasMol script viewer Motif-ligand binding stats  niche ..****         ****** *******                  ***                                       ******                     ***    ***   

25     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |    | | |    |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |    | | |    ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |    | | |                    | |^*****  ^*****     | |          ||||  || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |    | | |                    | |         |  |      | |          ||||  ********                                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..****         | |    | | |                    | |         ****      | |          ||||   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |    | | |                    | |                   | |          ****   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | | |                    | |                   ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    *****                    ***                                       ******                                  

26     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | |  | | |||||  |^***           | ||    |  ||  ^***   ^***         | |   ||||| ||                           | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | |  | | |||||  ^** |           | ||    |  ||  ||     | |          | |   ||^** ||                           | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |  | | |||||    | |           | |^*****  ^*****     | |          | |   || |  ||                           | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | |  | | |||||    | |           | |         |  |      | |          | |   ********                           | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |  | | |***|    ***           | |         |  |      | |          | |    | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  nest ..             | |  | | | | |                  | |         |  |      ***          | |    | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  niche ..             ****** *** ***                  ***         ****                   ***    ******                            ***   

27     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |    | |      |^***           | ||    |  ||  ^***   ^***         | |   ||||| ||                           | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |    | |      ^**             | ||    |  ||  ||     | |          | |   ||^** ||                           | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |    | |                      | |^*****  ^*****     | |          | |   || |  ||                           | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |    | |                      | |         |  |      | |          | |   ********                           | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |    | |                      | |         ****      | |          | |    | ****                            | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |    | |                      | |         |  |      | |          ***    | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | |                      | |         |  |      ***                 | |  |                            | |   
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    ***                      ***         ****                          ******                            ***   

28     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |  |    | |    | | |    |^***           | ||    |  || |^***   ^***         ||||  ||||| ||                             |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |  |    | |    | | |    ^**             | ||    |  || |||     | |          ||||  ||^** ||                             |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  | |  |    | |    | | |                    | |^*****  ^*****     | |          ||||  || |  ||                             |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  | |  |    | |    | | |                    | |         | ||      | |          ||||  ********                             |  |
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  | |  |    | |    | | |                    | |         ***|      | |          ||||   | |  |                              |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  | ****    | |    | | |                    | |         |  |      | |          ||||   | |  |                              ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |    | | |                    | |         |  |      | |          ****   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | | |                    | |         |  |      ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    *****                    ***         ****                          ******                                  

29     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |  | | |      |^***           | ||    |  || |^***   ^***          | |  ||||| ||                    | | | || |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |  | | |      ^**             | ||    |  || |||     | |           | |  ||^** ||                    | | | || |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |  | | |                      | |^*****  ^*****     | |           | |  || |  ||                    | | | || |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |  | | |                      | |         | ||      | |           | |  ********                    | | | || |   
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |         | |  | | |                      | |         ***|      | |           | |   | |  |                     | | | || |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |  | | |                      | |         |  |      | |           | |   | ****                     | | | || |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |  | | |                      | |         |  |      | |           ***   | |  |                     | | | || |   
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  | | |                      | |         |  |      ***                 | |  |                     | | | || |   
search RasMol script viewer Motif-ligand binding stats  niche ..****         ****** ***                      ***         ****                          ******                     *** ******   

30     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  | |       | |    | | |    |^***              |    |  ||  ^***   ^***         | |   ||||| ||                             |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  | |       | |    | | |    ^**                |    |  ||  ||     | |          | |   ||^** ||                             |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  | |       | |    | | |                       ^*****  ^*****     | |          | |   || |  ||                             |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  | |       | |    | | |                                |  |      | |          | |   ********                             |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  | |       | |    | | |                                |  |      | |          | |    | ****                              ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  | |       | |    | | |                                |  |      | |          ***    | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  | |       | |    | | |                                |  |      ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..******       ***    *****                                ****                          ******                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                               

31     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | |    | |    | |      |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | |    | |    | |      ^** |           | ||    |  ||  ||     | |          ||||  ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |    | |    | |        | |           | |^*****  ^*****     | |          ||||  || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |  | |    | |    | |        | |           | |         |  |      | |          ||||  ********                                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |  | |    | |    | |        | |           | |         |  |      | |          ||||   | ****                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  ***    | |    | |        ***           | |         |  |      | |          ****   | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | |                      | |         |  |      ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    ***                      ***         ****                          ******                                  

32     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |    | |  | | ||||   |^***           | ||    |  ||  ^***   ^***         ||||  ||||| ||                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |    | |  | | ||||   ^**             | ||    |  ||  ||     | |          ||||  ||^** ||                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |    | |  | | ||||                   | |^*****  ^*****     | |          ||||  || |  ||                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..      | |    | |  | | ||||                   | |         |  |      | |          ||||  ********                    | |      |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..      | |    | |  | | ||||                   | |         ****      | |          ||||   | ****                     | |      ****
search RasMol script viewer Motif-ligand binding stats  gammaturn ..      ***    | |  | | |***                   | |                   | |          |***   | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  nest ..             | |  | | | |                    | |                   ***          | |    | |  |                     | |          
search RasMol script viewer Motif-ligand binding stats  niche ..             ****** *****                    ***                                ***    ******                     ***          

33     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |  | | ||||   |^***           | ||    |  ||  ^***   ^***               ||||| ||                        | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |  | | ||||   ^**             | ||    |  ||  ||     | |                ||^** ||                        | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |  | | ||||                   | |^*****  ^*****     | |                || |  ||                        | |      
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |  | | ||||                   | |         |  |      | |                ********                        | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |  | | ||||                   | |         |  |      | |                 | ****                         | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |  | | |***                   | |         |  |      | |                 | |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |  | | | |                    | |         |  |      ***                 | |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  niche ..****         ****** *****                    ***         ****                          ******                         ***      

34     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |    | | | |  |^***           | ||    |  ||  ^***   ^***               ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |    | | | |  ^**             | ||    |  ||  ||     | |                ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |    | | | |  | |             | |^*****  ^*****     | |                || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |    | | | |  | |             | |         |  |      | |                ********                                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |    | | | |  | |             | |         |  |      | |                 | ****                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |    | | | |  | |             | |         |  |      ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***    *******  | |             ***         ****                          ******                                  
search RasMol script viewer Motif-ligand binding stats  stturn ..                             ***                                                                                               

35     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..     |  |    | |    | ||||   |^***           | ||    |  ||  ^***   ^***         ||||  |||||  |                           | |   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     |  |    | |    | ||||   ^** |           | ||    |  ||  ||     | |          ||||  ||^**  |                           | |   
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  |    | |    | ||||     | |           | |^*****  ^*****     | |          ||||  || |   |                           | |   
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..     |  |    | |    | ||||     | |           | |         |  |      | |          ||||  ********                           | |   
search RasMol script viewer Motif-ligand binding stats  betaturn ..     ****    | |    | ||||     | |           | |         |  |      | |          ||||   | |                               | |   
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     |  |    | |    | |***     ***           | |         |  |      | |          |***   | |                               | |   
search RasMol script viewer Motif-ligand binding stats  nest ..     |  |    | |    | | |                    | |         |  |      ***          | |    | |                               | |   
search RasMol script viewer Motif-ligand binding stats  niche ..     ****    ***    *****                    ***         ****                   ***    ***                               ***   
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                                               

36     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..             | | || | || |   |^***              |    |  |   ^***   ^***               ||||| ||                        | |      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             | | || | || |   ^**                |    |  |    |     | |                ||^** ||                        | |      
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | | || | || |                      ^*****  ^*****     | |                || |  ||                        | |      
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..             | | || | || |                                         | |                ********                        | |      
search RasMol script viewer Motif-ligand binding stats  betaturn ..             | | || | || |                                         | |                 | ****                         | |      
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | | || | |***                                         | |                 | |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  nest ..             | | || | |                                            ***                 | |  |                         | |      
search RasMol script viewer Motif-ligand binding stats  niche ..             ****** ***                                                                ******                         ***      
search RasMol script viewer Motif-ligand binding stats  stturn ..               ***                                                                                                             

37     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |         | |             |^***           | ||    |  ||  ^***   ^***               ||||| ||                                 
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |         | |             ^** |           | ||    |  ||  ||     | |                ||^** ||                                 
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |         | |               | |           | |^*****  ^*****     | |                || |  ||                                 
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |         | |               | |           | |         |  |      | |                ********                                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |         | |               | |           | |         |  |      | |                 | ****                                  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |         | |               ***           | |         |  |      | |                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  nest ..|  |         | |                             | |         |  |      ***                 | |  |                                  
search RasMol script viewer Motif-ligand binding stats  niche ..****         ***                             ***         ****                          ******                                  

38     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : POLYOMAVIRUS ENHANCER BINDING PROTEIN 2
member of: CATH:search2.60.40.720GENE3D:searchG3DSA_2.60.40.720PANTHER:searchPTHR11950PFAM:searchPF00853PIRSF:searchPIRSF009374PRINTS:searchONCOGENEAML1PROSITE PROFILES:searchPS51062, SUPERFAMILY:searchSSF49417UniProt:searchQ01196
sec str:  ....hhhh.....ee.....eeee....eee........eeeee......eeeeeeeeee....eeeee..eeeee..eeee...eeeee......eeeeeee.....eeeeeee..eee.........
sequence :  ..VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRR
seq num:  ..52        62        72        82        92        102       112       122       132       142       152       162       172    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..|  |  | |    | |  | | | |    |^***           | ||    |  || |^***   ^***         | |   |||||  |                             |  |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  | |    | |  | | | |    ^**             | ||    |  || |||     | |          | |   ||^**  |                             |  |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |  | |    | |  | | | |                    | |^*****  ^*****     | |          | |   || |   |                             |  |
search RasMol script viewer Motif-ligand binding stats  ATP_GTP_A ..|  |  | |    | |  | | | |                    | |         | |||     | |          | |   ********                             |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |  | |    | |  | | | |                    | |         *****     | |          | |    | |                                 |  |
search RasMol script viewer