triangle PDBeMotif: 1c2o  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.1.7
Classification hydrolase    | release date: Mon, Jul 26, 1999
Title electrophorus electricus acetylcholinesterase
Authors P.MARCHOT, Y.BOURNE
Method X-RAY DIFFRACTION (resolution: 4.20Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B,C,D sequence:
DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTE
MWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGS
REAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEA
RRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDL
QVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGD
HNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFA
RTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ACETYLCHOLINESTERASE
member of: GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
sec str:  ......eeee..eeee.eeeee..eeeee...ee.ee..hhhhh....ee......eee..................hhhhhh............eeeeeee.......eeeeeee...........hhhhhhhhhhhh...eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhh..hhhhh.eeeee...........hhhhhhhhhhhhhhhh.........hhhhhhhhhh..hhhhhhhhhhhh......................hhhhhhhhh.....eeeeeee...hhhhhhh.............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.eee.........hhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh......................eeeee.......ee..hhhhhhhhhhhhhhhhh..
sequence :  ..DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||| ||  || |||   | | ^***|   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ^***       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | ||^*** |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||**^*  || |||   | | |  ||   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |^** |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | ^***||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |^***       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  ********^     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  |  ^*****   | ^*****| ^*****   | || |         ^*****           | |  |   |  |     |||| |     |     | |        ^*****|  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |^***** ^*****|   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       |^*****  |        ||  || ||| |                           || |||      | | |  | | |  ^*****| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |||| |     |     | |        ||| | |  ||  |       | |           |  | |  |     | |||            || *************^**  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |**^********     | |        ||| | |  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| | |  ||  |       | |           |  | |  |     *****            || |||| |||    ||||  *****  ||  |  |        | | |  | |   |*****  *****|       |   |   |  ||  |*****|| |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       ******|  |        ||  || ||| |                           *****|      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | *****       |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| | |  ||  |       | |           |  | |  |     | ||             || |||*****    ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||       *****   |  ||  ||  | || |   |  |       ||||        |  |||||          | |  |   |  ||  ||||       || || |  |        ||  |***** |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| | |  ||  |       | |           |  | |  |     | ||             || |||***|     ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||               |  ||  ||  | || |   |  |       ***|        |  |***|          | |  |   |  ||  ||||       || || |  |        ||  |***|  |                           || |||      | | |  | | |  | ||||| || |||  ***| |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |  ****        ****    |  |       | ****                          | |  |   ****     | || |           | |        ||| | |  ||  |       | |           |  | ****     ****             *****|****     ****  ************  |        | | |  | |   |****   *****|               |  |*********** |   |  |       ||||        |  | | |          | ****   ****|  ||||       ***** ****        ||  |****  |                           *****|      | | |  | | **** ****| |****|  |  | |           |   ||   | | |  |||||         | |    | |        | ****        |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |                      |  |       | || |                          ***  |   |  |     | |***           ***        ||| | |  ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |   |  |        | | |  | |   |          | |               |  |         |  |   |  |       ||||        |  | ***          |        |  ||  ||||             |  |        ||  |   |  |                              | |      | | |  | |       || | |  |||  |  | |           |   ||   | | |  *****         | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                      |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |   |  |        | | |  | |   |          ***               |  |         |  |   |  |       ****        |  |              |        |  ||  |***             |  |        ||  |   |  |                              ***      | | |  | |       |*** |  ***  |  ***           |   ||   *** |                ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche .. ****                      ****       ******                            ****   ****     ***                         ||    ********                     **** ****                                      ||   |   ****   ****        | | **** |   |                            ****         ****   ****                   ****              |        ******** |              ****        |****   ****                                       *** ******       |    |   |****                |   ||   | ***                       ***                      |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                        | |                         ||                                                                                ||   |                      | |      |   |                                                                                         |            |    |                          |   |                                                               |    ******                   |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                        | |                         ||                                                                                ||   |                      | |      *****                                                                                         |            |    |                          |   |                                                               |        |                    |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                        | |                         ||                                                                                |*****                      | |                                                                                                    |            ******                          *****                                                               |        |                    **********                                                    *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                        ***                         ||                                                                                ||                          ***                                                                                                    |                                                                                                                |        |                                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                    **                                                                                **                                                                                                                                 *                                                                                                                *        *                                                                                       

chain B : ACETYLCHOLINESTERASE
member of: GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
sec str:  ......eeee..eeee.eeeee..eeeee...ee.ee..hhhhh....ee......eee..................hhhhhh............eeeeeee.......eeeeeee...........hhhhhhhhhhhh...eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhh..hhhhh.eeeee...........hhhhhhhhhhhhhhhh.........hhhhhhhhhh..hhhhhhhhhhhh......................hhhhhhhhh.....eeeeeee...hhhhhhh.............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.eee.........hhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh......................eeeee.......ee..hhhhhhhhhhhhhhhhh..
sequence :  ..DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||| ||  || |||   | | ^***|   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ^***       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | ||^*** |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||**^*  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |^** |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | ^***||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |^***       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  ********^     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  |  ^*****   | ^*****| ^*****   | || |         ^*****           | |  |   |  |     |||| |     |     | |        ^***** | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |^***** ^*****|   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       |^*****  |        ||  || ||| |                           || |||      | | |  | | |  ^*****| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |||| |     |     | |        ||| |  | ||  |       | |           |  | |  |     | |||            || *************^**  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |**^********     | |        ||| |  | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| |  | ||  |       | |           |  | |  |     *****            || |||| |||    ||||  *****  ||  |  |        | | |  | |   |*****  *****|       |   |   |  ||  |*****|| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       ******|  |        ||  || ||| |                           *****|      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | *****       |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| |  | ||  |       | |           |  | |  |     | ||             || |||*****    ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||       *****   |  ||  ||  | || |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || || |  |        ||  |***** |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| |  | ||  |       | |           |  | |  |     | ||             || |||***|     ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||               |  ||  ||  | || |   |  |       ***         |  |***|          | |  |   |  ||  ||||       || || |  |        ||  |***|  |                           || |||      | | |  | | |  | ||||| || |||  ***| |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |  ****        ****    |  |       | ****                          | |  |   ****     | || |           | |        ||| |  | ||  |       | |           |  | ****     ****             *****|****     ****  ************  |        | | |  | |   |****   *****|               |  |*********** |   |  |       | |         |  | | |          | ****   ****|  ||||       ***** ****        ||  |****  |                           *****|      | | |  | | **** ****| |****|  |  | |           |   ||   | | |  |||||         | |    | |        | ****        |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |                      |  |       | || |                          ***  |   |  |     | |***           ***        ||| |  | ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |   |  |        | | |  | |   |          | |               |  |         |  |   |  |       | |         |  | ***          |        |  ||  ||||             |  |        ||  |   |  |                              | |      | | |  | |       || | |  |||  |  | |           |   ||   | | |  *****         | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                      |  |       | || |                            |  |   |  |     | |                         ||***  | ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |   |  |        | | |  | |   |          ***               |  |         |  |   |  |       ***         |  |              |        |  ||  |***             |  |        ||  |   |  |                              ***      | | |  | |       |*** |  ***  |  ***           |   ||   *** |                ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche .. ****                      ****       ******                            ****   ****     ***                         ||     *******                     **** ****                                      ||   |   ****   ****        | | **** |   |                            ****         ****   ****                   ****              |        ******** |              ****        |****   ****                                       *** ******       |    |   |****                |   ||   | ***                       ***                      |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                        | |                         ||                                                                                ||   |                      | |      |   |                                                                                         |            |    |                          |   |                                                               |    ******                   |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                        | |                         ||                                                                                ||   |                      | |      *****                                                                                         |            |    |                          |   |                                                               |        |                    |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                        | |                         ||                                                                                |*****                      | |                                                                                                    |            ******                          *****                                                               |        |                    **********                                                    *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                        ***                         ||                                                                                ||                          ***                                                                                                    |                                                                                                                |        |                                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                    **                                                                                **                                                                                                                                 *                                                                                                                *        *                                                                                       

chain C : ACETYLCHOLINESTERASE
member of: GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
sec str:  ......eeee..eeee.eeeee..eeeee...ee.ee..hhhhh....ee......eee..................hhhhhh............eeeeeee.......eeeeeee...........hhhhhhhhhhhh...eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhh..hhhhh.eeeee...........hhhhhhhhhhhhhhhh.........hhhhhhhhhh..hhhhhhhhhhhh......................hhhhhhhhh.....eeeeeee...hhhhhhh.............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.eee.........hhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh......................eeeee.......ee..hhhhhhhhhhhhhhhhh..
sequence :  ..DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||| ||  || |||   | | ^***|   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ^***       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | ||^*** |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||**^*  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |^** |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | ^***||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |^***       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  ********^     |     | |        ||| || | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  |  ^*****   | ^*****| ^*****   | || |         ^*****           | |  |   |  |     |||| |     |     | |        ^***** | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |^***** ^*****|   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       |^*****  |        ||  || ||| |                           || |||      | | |  | | |  ^*****| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |||| |     |     | |        ||| |  | ||  |       | |           |  | |  |     | |||            || *************^**  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |**^********     | |        ||| |  | ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| |  | ||  |       | |           |  | |  |     *****            || |||| |||    ||||  *****  ||  |  |        | | |  | |   |*****  *****|       |   |   |  ||  |*****|| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       ******|  |        ||  || ||| |                           *****|      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | *****       |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| |  | ||  |       | |           |  | |  |     | ||             || |||*****    ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||       *****   |  ||  ||  | || |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || || |  |        ||  |***** |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| |  | ||  |       | |           |  | |  |     | ||             || |||***|     ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||               |  ||  ||  | || |   |  |       ***         |  |***|          | |  |   |  ||  ||||       || || |  |        ||  |***|  |                           || |||      | | |  | | |  | ||||| || |||  ***| |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |  ****        ****    |  |       | ****                          | |  |   ****     | || |           | |        ||| |  | ||  |       | |           |  | ****     ****             *****|****     ****  ************  |        | | |  | |   |****   *****|               |  |*********** |   |  |       | |         |  | | |          | ****   ****|  ||||       ***** ****        ||  |****  |                           *****|      | | |  | | **** ****| |****|  |  | |           |   ||   | | |  |||||         | |    | |        | ****        |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |                      |  |       | || |                          ***  |   |  |     | |***           ***        ||| |  | ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |   |  |        | | |  | |   |          | |               |  |         |  |   |  |       | |         |  | ***          |        |  ||  ||||             |  |        ||  |   |  |                              | |      | | |  | |       || | |  |||  |  | |           |   ||   | | |  *****         | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                      |  |       | || |                            |  |   |  |     | |                         ||***  | ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |   |  |        | | |  | |   |          ***               |  |         |  |   |  |       ***         |  |              |        |  ||  |***             |  |        ||  |   |  |                              ***      | | |  | |       |*** |  ***  |  ***           |   ||   *** |                ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche .. ****                      ****       ******                            ****   ****     ***                         ||     *******                     **** ****                                      ||   |   ****   ****        | | **** |   |                            ****         ****   ****                   ****              |        ******** |              ****        |****   ****                                       *** ******       |    |   |****                |   ||   | ***                       ***                      |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                        | |                         ||                                                                                ||   |                      | |      |   |                                                                                         |            |    |                          |   |                                                               |    ******                   |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                        | |                         ||                                                                                ||   |                      | |      *****                                                                                         |            |    |                          |   |                                                               |        |                    |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                        | |                         ||                                                                                |*****                      | |                                                                                                    |            ******                          *****                                                               |        |                    **********                                                    *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                        ***                         ||                                                                                ||                          ***                                                                                                    |                                                                                                                |        |                                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                    **                                                                                **                                                                                                                                 *                                                                                                                *        *                                                                                       

chain D : ACETYLCHOLINESTERASE
member of: GENE3D:searchG3DSA_3.40.50.1820PANTHER:searchPTHR11559/searchPTHR11559_SF171PFAM:searchPF00135PRINTS:searchCHOLNESTRASEPRODOM:searchPD415333PROSITE PATTERNS:searchPS00122/searchPS00941, SUPERFAMILY:searchSSF53474UniProt:searchP21836
sec str:  ......eeee..eeee.eeeee..eeeee...ee.ee..hhhhh....ee......eee..................hhhhhh............eeeeeee.......eeeeeee...........hhhhhhhhhhhh...eeeee...hhhhhhh..........hhhhhhhhhhhhhhhhhhhhh.eeeeeeeeeeehhhhhhhhhhhhh..hhhhh.eeeee...........hhhhhhhhhhhhhhhh.........hhhhhhhhhh..hhhhhhhhhhhh......................hhhhhhhhh.....eeeeeee...hhhhhhh.............hhhhhhhhhhhhh...hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eee.eee.........hhhhh.....hhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhhh......................eeeee.......ee..hhhhhhhhhhhhhhhhh..
sequence :  ..DPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGFEGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGDFQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYWTNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
seq num:  ..5         15        25        35        45        55        65        75        85        95        105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315       325       335       345       355       365       375       385       395       405       415       425       435       445       455       465       475       485       495       505       515       525       535      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||| ||  || |||   | | ^***|   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ^***       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | ||^*** |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |||| |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||**^*  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   |^** |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |  |||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || ||  |       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  |  |||| |     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | ^***||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |^***       |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. |  |  |  |    |   | ||   || ||   |   | || |         |    |           | |  |   |  |  ********^     |     | |        ||| |||  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||   | | |  ||   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. |  |  |  ^*****   | ^*****| ^*****   | || |         ^*****           | |  |   |  |     |||| |     |     | |        ^*****|  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |^***** ^*****|   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       |^*****  |        ||  || ||| |                           || |||      | | |  | | |  ^*****| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_1 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |||| |     |     | |        ||| | |  ||  |       | |           |  | |  |     | |||            || *************^**  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  CARBOXYLESTERASE_B_2 .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     |**^********     | |        ||| | |  ||  |       | |           |  | |  |     | |||            || |||| |||    ||||  |  ||  ||  |  |        | | |  | |   ||  ||  || |||       |   |   |  ||  ||  |||| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || ||||  |        ||  || ||| |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  ||       |   |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| | |  ||  |       | |           |  | |  |     *****            || |||| |||    ||||  *****  ||  |  |        | | |  | |   |*****  *****|       |   |   |  ||  |*****|| |   |  |       | |         |  |||||          | |  |   |  ||  ||||       ******|  |        ||  || ||| |                           *****|      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | *****       |   |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| | |  ||  |       | |           |  | |  |     | ||             || |||*****    ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||       *****   |  ||  ||  | || |   |  |       | |         |  |||||          | |  |   |  ||  ||||       || || |  |        ||  |***** |                           || |||      | | |  | | |  | ||||| || |||  | || |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  asxturn .. |  |  |  |        |  |    |  |       | || |                          | |  |   |  |     | || |           | |        ||| | |  ||  |       | |           |  | |  |     | ||             || |||***|     ||||  |  ||  ||  |  |        | | |  | |   ||  |   || |||               |  ||  ||  | || |   |  |       ***         |  |***|          | |  |   |  ||  ||||       || || |  |        ||  |***|  |                           || |||      | | |  | | |  | ||||| || |||  ***| |           |   ||   | | |  |||||         | |    | |        | |  |        |   |
search RasMol script viewer Motif-ligand binding stats  betaturn .. |  |  ****        ****    |  |       | ****                          | |  |   ****     | || |           | |        ||| | |  ||  |       | |           |  | ****     ****             *****|****     ****  ************  |        | | |  | |   |****   *****|               |  |*********** |   |  |       | |         |  | | |          | ****   ****|  ||||       ***** ****        ||  |****  |                           *****|      | | |  | | **** ****| |****|  |  | |           |   ||   | | |  |||||         | |    | |        | ****        |   |
search RasMol script viewer Motif-ligand binding stats  gammaturn .. |  |                      |  |       | || |                          ***  |   |  |     | |***           ***        ||| | |  ||  |       | |           |  | |  |     | |                 | |          ||   |   |  |   |  |        | | |  | |   |          | |               |  |         |  |   |  |       | |         |  | ***          |        |  ||  ||||             |  |        ||  |   |  |                              | |      | | |  | |       || | |  |||  |  | |           |   ||   | | |  *****         | |    | |        | |           |   |
search RasMol script viewer Motif-ligand binding stats  nest .. |  |                      |  |       | || |                            |  |   |  |     | |                         ||*** |  ||  |       ***           |  | |  |     ***                 ***          ||   |   |  |   |  |        | | |  | |   |          ***               |  |         |  |   |  |       ***         |  |              |        |  ||  |***             |  |        ||  |   |  |                              ***      | | |  | |       |*** |  ***  |  ***           |   ||   *** |                ***    | |        ***           |   |
search RasMol script viewer Motif-ligand binding stats  niche .. ****                      ****       ******                            ****   ****     ***                         ||    ********                     **** ****                                      ||   |   ****   ****        | | **** |   |                            ****         ****   ****                   ****              |        ******** |              ****        |****   ****                                       *** ******       |    |   |****                |   ||   | ***                       ***                      |   |
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                                        | |                         ||                                                                                ||   |                      | |      |   |                                                                                         |            |    |                          |   |                                                               |    ******                   |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                                        | |                         ||                                                                                ||   |                      | |      *****                                                                                         |            |    |                          |   |                                                               |        |                    |   ||   |                                                    |   |
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                                                        | |                         ||                                                                                |*****                      | |                                                                                                    |            ******                          *****                                                               |        |                    **********                                                    *****
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                                                        ***                         ||                                                                                ||                          ***                                                                                                    |                                                                                                                |        |                                                                                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                                                                                    **                                                                                **                                                                                                                                 *                                                                                                                *        *                                                                                       

   New search    1c2o:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML