triangle PDBeMotif: 1bwn  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   2.7.1.112
Classification transferase    | release date: Fri, Sep 25, 1998
Title ph domain and btk motif from bruton's tyrosine kinase mutant complex with ins(1,3,4,5)p4
Authors A.RILEY, B., E.BARALDI, K.DJINOVIC CARUGO, M.HYVOENEN, M.SARASTE, P.LO SURDO
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN   search 4IP 4IP binding statistics 4IP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPR
RGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKN
AMGCQILEN
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRUTON'S TYROSINE KINASE
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR24418/searchPTHR24418_SF92PFAM:searchPF00169/searchPF00779PRINTS:searchTECBTKDOMAINPROSITE PROFILES:searchPS50003/searchPS51113, SMART:searchSM00107/searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ06187
JMol viewer RasMol script viewer  4IP 172B  ..                                           *                                      ..                                                                                    
JMol viewer RasMol script viewer  4IP 172A  ..                                       *   |       *                              ..                                                                                    
JMol viewer RasMol script viewer  4IP 1A  ..          * *****  ** * * *          * |   |       *                              ..                                                                                    
JMol viewer RasMol script viewer  ZN 171A  ..          | |||||  || | | |          | |   |       |                              ..                                                        *          **         *     
sec str:  ......eeeeeeee...........eeeeeeee...eeeee...........eeeeeehhheeeeee........hhh.........hhhhhhhh....eeeeeee...eeeeee..hhhhhhhhhhhhhhh......................................
sequence :  ..AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRG..SEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
seq num:  ..2         12        22        32        42        52        62        72          ..87        97        107       117       127       137       147       157       167 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..             ||**^*|           | ||      || ||**^***^* || |||| |        || ||     ..| || ||  ||                 |  |             |  |  |    | |    |    | |||| |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             ||||  |           | ||      || |||||^** | || |||| |        || ||     ..| || ||  ||                 |  |             |  |  |    | |    |    | |^** |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ||||  |           | ||      || |||||    | || ||^***        || ||     ..^*** |^***|                 ^***             |  |  |    | |    |    | | |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             ||||  |           | ||      || ||||^***** || ||||          || ||     ..  |  ||  ||                                  |  |  |    | |    ^***** | |  |        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..             ||||  |           | ||      || ^***       || ||||          || ||     ..  |  ||  ||                                  |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             ||||  |           | ||      || |||        || ||||          *****     ..  *********                                  |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..             ||||  |           | ||      || |||        || ||**          || ||     ..  |  ||  |                                   |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             ||||  |           | ||      ******        || ||            || ||     ..  |  ||  |                                   |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ||||  |           | ||      |****|        ****|            *****     ..  ********                                   |  |  |    | |         | | ****        
search RasMol script viewer Motif-ligand binding stats  nest ..             ****  |           | ||      |  ***         |  |             |  |     ..                                             |  |  |    | |         *** |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..              ******           ****      |    |         ****             ****     ..                                             *******    ***           ******        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               | |       ******                                   ..                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                               ***                                                ..                                                                                    

chain B : BRUTON'S TYROSINE KINASE
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR24418/searchPTHR24418_SF92PFAM:searchPF00169/searchPF00779PRINTS:searchTECBTKDOMAINPROSITE PROFILES:searchPS50003/searchPS51113, SMART:searchSM00107/searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ06187
JMol viewer RasMol script viewer  4IP 172B  ..                        *              *           *                          ..                                                                                   
JMol viewer RasMol script viewer  4IP 1B  ..          * *****  ** * | *          * |           *                          ..                                                                                   
JMol viewer RasMol script viewer  ZN 171B  ..          | |||||  || | | |          | |           |                          ..                                                       *          **         *     
JMol viewer RasMol script viewer  4IP 172A  ..          | |||||  || | | |          | |   *       |                          ..                                                       |          ||         |     
sec str:  ......eeeeeeee...........eeeeeeee...eeeee...........eeeeeehhheeeeee........hhh.....hhhhhhh....eeeeeee..eeeeeee..hhhhhhhhhhhhhhh......................................
sequence :  ..AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI..EMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
seq num:  ..2         12        22        32        42        52        62        72      ..88        98        108       118       128       138       148       158          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   ||        ||**^*|           | ||      || ||**^***^*  |  ||  |        || || ..  | || |||        |  |     | ||  |      |  ||  |  |           || | | |||| |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||        ||||  |           | ||      || |||||^** |  |  ||  |        || || ..  | || |||        |  |     | ||  |      |  ||  |  |           || | | |^** |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||        ||||  |           | ||      || |||||    |  |  |^***        || || ..*** |^***|        |  |     ^***  |      |  ||  |  |           || | | | |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||        ||||  |           | ||      || ||||^*****  |  |            || || ..    || |||        |  |       |   |      |  ||  |  |           ^***** | |  |        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   ||        ||||  |           | ||      || ^***        |  |            || || ..    || |||        |  |       |   |      |  ||  |  |            | | | | |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||        ||||  |           | ||      || |||         |  |            || || ..    ******        |  |       |   |      *****  |  |            | | | | |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..   **        ||||  |           | ||      || |||         |  |            || || ..    || ||         |  |       |   |      |  ||  |  |            | | | | |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ||||  |           | ||      |****|         |  |            ***** ..    *****         ****       |   |      ********  |            | | | | ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ||||  |           | ||      |  | |         |  |             |  | ..                             |   |          |  |  |            *** | | |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..             ****  |           | ||      |  ***         |  |             |  | ..                             |   |          |  |  |                *** |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                ****           ****      |    |         ****             **** ..                             |   |          *******                    ****        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               | |       ******                               ..                             |   |                                                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               | |                                            ..                             *****                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                               ***                                            ..                                                                                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRUTON'S TYROSINE KINASE
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR24418/searchPTHR24418_SF92PFAM:searchPF00169/searchPF00779PRINTS:searchTECBTKDOMAINPROSITE PROFILES:searchPS50003/searchPS51113, SMART:searchSM00107/searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ06187
JMol viewer RasMol script viewer  4IP 172B  ..                                           *                                      ..                                                                                    
JMol viewer RasMol script viewer  4IP 172A  ..                        * *            *   |     * *                              ..                                                                                    
JMol viewer RasMol script viewer  4IP 1A  ..          * *****  ** * * *          * |   |     | *                              ..                                                                                    
JMol viewer RasMol script viewer  ZN 171A  ..          | |||||  || | | |          | |   |     | |                              ..                                                        *          **         *     
sec str:  ......eeeeeeee...........eeeeeeee...eeeee...........eeeeeehhheeeeee........hhh.........hhhhhhhh....eeeeeee...eeeeee..hhhhhhhhhhhhhhh......................................
sequence :  ..AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQIPRRG..SEMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
seq num:  ..2         12        22        32        42        52        62        72          ..87        97        107       117       127       137       147       157       167 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..             ||**^*|           | ||      || ||**^***^* || |||| |        || ||     ..| || ||  ||                 |  |             |  |  |    | |    |    | |||| |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             ||||  |           | ||      || |||||^** | || |||| |        || ||     ..| || ||  ||                 |  |             |  |  |    | |    |    | |^** |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ||||  |           | ||      || |||||    | || ||^***        || ||     ..^*** |^***|                 ^***             |  |  |    | |    |    | | |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             ||||  |           | ||      || ||||^***** || ||||          || ||     ..  |  ||  ||                                  |  |  |    | |    ^***** | |  |        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..             ||||  |           | ||      || ^***       || ||||          || ||     ..  |  ||  ||                                  |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..             ||||  |           | ||      || |||        || ||||          *****     ..  *********                                  |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..             ||||  |           | ||      || |||        || ||**          || ||     ..  |  ||  |                                   |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..             ||||  |           | ||      ******        || ||            || ||     ..  |  ||  |                                   |  |  |    | |         | | |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ||||  |           | ||      |****|        ****|            *****     ..  ********                                   |  |  |    | |         | | ****        
search RasMol script viewer Motif-ligand binding stats  nest ..             ****  |           | ||      |  ***         |  |             |  |     ..                                             |  |  |    | |         *** |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..              ******           ****      |    |         ****             ****     ..                                             *******    ***           ******        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               | |       ******                                   ..                                                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                               ***                                                ..                                                                                    

chain B : BRUTON'S TYROSINE KINASE
member of: CATH:search2.30.29.30GENE3D:searchG3DSA_2.30.29.30PANTHER:searchPTHR24418/searchPTHR24418_SF92PFAM:searchPF00169/searchPF00779PRINTS:searchTECBTKDOMAINPROSITE PROFILES:searchPS50003/searchPS51113, SMART:searchSM00107/searchSM00233SUPERFAMILY:searchSSF50729UniProt:searchQ06187
JMol viewer RasMol script viewer  4IP 172B  ..                        * *            *         * *                          ..                                                                                   
JMol viewer RasMol script viewer  4IP 1B  ..          * *****  ** * | *          * |         | *                          ..                                                                                   
JMol viewer RasMol script viewer  ZN 171B  ..          | |||||  || | | |          | |         | |                          ..                                                       *          **         *     
JMol viewer RasMol script viewer  4IP 172A  ..          | |||||  || | | |          | |   *     | |                          ..                                                       |          ||         |     
sec str:  ......eeeeeeee...........eeeeeeee...eeeee...........eeeeeehhheeeeee........hhh.....hhhhhhh....eeeeeee..eeeeeee..hhhhhhhhhhhhhhh......................................
sequence :  ..AAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYKYDFERGRRGSKKGSIDVEKITCVETVVPEKNPPPERQI..EMEQISIIERFPYPFQVVYDEGPLYVFSPTEELRKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILEN
seq num:  ..2         12        22        32        42        52        62        72      ..88        98        108       118       128       138       148       158          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..   ||        ||**^*|           | ||      || ||**^***^*  |  ||  |        || || ..  | || |||        |  |     | ||  |      |  ||  |  |           || | | |||| |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   ||        ||||  |           | ||      || |||||^** |  |  ||  |        || || ..  | || |||        |  |     | ||  |      |  ||  |  |           || | | |^** |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ||        ||||  |           | ||      || |||||    |  |  |^***        || || ..*** |^***|        |  |     ^***  |      |  ||  |  |           || | | | |  |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   ||        ||||  |           | ||      || ||||^*****  |  |            || || ..    || |||        |  |       |   |      |  ||  |  |           ^***** | |  |        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..   ||        ||||  |           | ||      || ^***        |  |            || || ..    || |||        |  |       |   |      |  ||  |  |            | | | | |  |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..   ||        ||||  |           | ||      || |||         |  |            || || ..    ******        |  |       |   |      *****  |  |            | | | | |  |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..   **        ||||  |           | ||      || |||         |  |            || || ..    || ||         |  |       |   |      |  ||  |  |            | | | | |  |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..             ||||  |           | ||      |****|         |  |            ***** ..    *****         ****       |   |      ********  |            | | | | ****        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             ||||  |           | ||      |  | |         |  |             |  | ..                             |   |          |  |  |            *** | | |  |        
search RasMol script viewer Motif-ligand binding stats  nest ..             ****  |           | ||      |  ***         |  |             |  | ..                             |   |          |  |  |                *** |  |        
search RasMol script viewer Motif-ligand binding stats  niche ..                ****           ****      |    |         ****             **** ..                             |   |          *******                    ****        
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                               | |       ******                               ..                             |   |                                                 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                               | |                                            ..                             *****                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                               ***                                            ..                                                                                   

   New search    1bwn:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML