triangle PDBeMotif: 1bq8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification metal binding protein    | release date: Sat, Aug 22, 1998
Title rubredoxin (methionine mutant) from pyrococcus furiosus
Authors D.C.REES, D.M.KURTZ, H.HUANG, M.K.EIDSNESS, M.W.W.ADAMS, R.A.SCOTT, R.BAU
Method X-RAY DIFFRACTION (resolution: 1.10Å)
PDBe Citation   
Small molecules:    search FE FE binding statistics FE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (RUBREDOXIN)
member of: CATH:search2.20.28.10GENE3D:searchG3DSA_2.20.28.10PANTHER:searchPTHR10909PFAM:searchPF00301PIRSF:searchPIRSF000071PRINTS:searchRUBREDOXINPROSITE PATTERNS:searchPS00202, PROSITE PROFILES:searchPS50903, SUPERFAMILY:searchSSF57802UniProt:searchP24297
JMol viewer RasMol script viewer  FE 55A  ..     *  *                             *  *            
sec str:  ....eeee.....eee.....hhh.......hhh.............hhheee...
sequence :  ..MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
seq num:  ..1         11        21        31        41        51  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     |  | |  |  ||   ||||  ^***|||  | |  ||| |^***    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     |  | |  |  ||   |^*****|| |||  | |  |^*****|     
search RasMol script viewer Motif-ligand binding stats  RUBREDOXIN ..     |  | |  |  ||   | ||  ||| |******^**^*| |  |     
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     |  | |  *****   | ||  |*****|  |    | | |  |     
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..     ******  |  |    | ||  ||| |||  |    | | |  |     
search RasMol script viewer Motif-ligand binding stats  betaturn ..        | |  ****    | |*************    | | |  |     
search RasMol script viewer Motif-ligand binding stats  nest ..        ***          ***|  | |  ||  |    *** |  |     
search RasMol script viewer Motif-ligand binding stats  niche ..                        **** ********        ****     

   New search    1bq8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors