triangle PDBeMotif: 1bnd  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification complex (growth factor/growth factor)    | release date: Mon, Dec 12, 1994
Title structure of the brain-derived neurotrophic factor(slash)neu 3 heterodimer
Authors C.RADZIEJEWSKI, D.I.STUART, E.Y.JONES, R.C.ROBINSON
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search IPA IPA binding statistics IPA
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
HSDPARRGQLSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQC
RTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Chain B sequence:
YAEHKSHRGEVSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTQNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCK
TSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRAIN DERIVED NEUROTROPHIC FACTOR
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11589/searchPTHR11589_SF3PFAM:searchPF00243PIRSF:searchPIRSF001789PRINTS:searchBDNFACTOR/searchNGFPRODOM:searchPD002052PROSITE PATTERNS:searchPS00248, PROSITE PROFILES:searchPS50270, SMART:searchSM00140SUPERFAMILY:searchSSF57501UniProt:searchP23560
JMol viewer RasMol script viewer  IPA 500A  ..                     **  *                                                    *                 *            
sec str:  .........eeeeeeehhhh.eee.....eee...eee....eee.eeeeeee....hhh..........eeeeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeeee.
sequence :  ..GQLSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIK
seq num:  ..8         18        28        38        48        58        68        78        88        98        108      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  ||  |  | ||  |  | |||  || |                  |  |    ||  |||  |   |             ^**|         ||     ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***^***  ^***  ^*** |||  ^***                  |  |    ||  |||  |   |              | |         ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |        |^*****                    |  |    ||  |||  |   |              | |         ||        
search RasMol script viewer Motif-ligand binding stats  NGF_1 ..             | |        | |                        |  |    *^***********^              | |         ||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             | |        | |                        |  |     |  |*****                  | |         ||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |        | |                        |  |     |  | |  |                  | |         **        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |        | |                        |  |     |  ***  |                  | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..             | |        ***                        |  |     |  | |  |                  ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..             | |                                   ****     **** ****                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                             

chain B : NEUROTROPHIN 3
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11589/searchPTHR11589_SF4PFAM:searchPF00243PIRSF:searchPIRSF001789PRINTS:searchNGFPRODOM:searchPD002052PROSITE PATTERNS:searchPS00248, PROSITE PROFILES:searchPS50270, SMART:searchSM00140SUPERFAMILY:searchSSF57501UniProt:searchP20783
sec str:  ....eee...eeeeee....eee.....eee...............eeeeee..................eeeeeeeeeeeeeee.......eeeeeeeeeeeeeeee..
sequence :  ..RGEVSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTQNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRK
seq num:  ..8         18        28        38        48        58        68        78        88        98        108     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*   |  |      ^** |  | | |       | |                      ||  ||  ||   |            |  |                 ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***          ^*** | |       | |                      ||  ||  ||   |            |  |                    
search RasMol script viewer Motif-ligand binding stats  NGF_1 ..                     | | |       | |                      *^***********^            |  |                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | |       | |                       |  |*****                |  |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     *** |       | |                       |  ||  |                 |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |       | |                       |  |****                 ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***       | |                       |  |                                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ***                       ****                                             

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : BRAIN DERIVED NEUROTROPHIC FACTOR
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11589/searchPTHR11589_SF3PFAM:searchPF00243PIRSF:searchPIRSF001789PRINTS:searchBDNFACTOR/searchNGFPRODOM:searchPD002052PROSITE PATTERNS:searchPS00248, PROSITE PROFILES:searchPS50270, SMART:searchSM00140SUPERFAMILY:searchSSF57501UniProt:searchP23560
JMol viewer RasMol script viewer  IPA 500A  ..                     **  *                                                    *                 *            
sec str:  .........eeeeeeehhhh.eee.....eee...eee....eee.eeeeeee....hhh..........eeeeeeeeeeeeeeeee.....eeeeeeeeeeeeeeeeee.
sequence :  ..GQLSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIK
seq num:  ..8         18        28        38        48        58        68        78        88        98        108      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |  ||  |  | ||  |  | |||  || |                  |  |    ||  |||  |   |             ^**|         ||     ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   ^***^***  ^***  ^*** |||  ^***                  |  |    ||  |||  |   |              | |         ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             | |        |^*****                    |  |    ||  |||  |   |              | |         ||        
search RasMol script viewer Motif-ligand binding stats  NGF_1 ..             | |        | |                        |  |    *^***********^              | |         ||        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..             | |        | |                        |  |     |  |*****                  | |         ||        
search RasMol script viewer Motif-ligand binding stats  betabulge ..             | |        | |                        |  |     |  | |  |                  | |         **        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             | |        | |                        |  |     |  ***  |                  | |                   
search RasMol script viewer Motif-ligand binding stats  nest ..             | |        ***                        |  |     |  | |  |                  ***                   
search RasMol script viewer Motif-ligand binding stats  niche ..             | |                                   ****     **** ****                                        
search RasMol script viewer Motif-ligand binding stats  stturn ..             ***                                                                                             

chain B : NEUROTROPHIN 3
member of: CATH:search2.10.90.10GENE3D:searchG3DSA_2.10.90.10PANTHER:searchPTHR11589/searchPTHR11589_SF4PFAM:searchPF00243PIRSF:searchPIRSF001789PRINTS:searchNGFPRODOM:searchPD002052PROSITE PATTERNS:searchPS00248, PROSITE PROFILES:searchPS50270, SMART:searchSM00140SUPERFAMILY:searchSSF57501UniProt:searchP20783
sec str:  ....eee...eeeeee....eee.....eee...............eeeeee..................eeeeeeeeeeeeeee.......eeeeeeeeeeeeeeee..
sequence :  ..RGEVSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTQNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRK
seq num:  ..8         18        28        38        48        58        68        78        88        98        108     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..*   |  |      ^** |  | | |       | |                      ||  ||  ||   |            |  |                 ^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    ^***          ^*** | |       | |                      ||  ||  ||   |            |  |                    
search RasMol script viewer Motif-ligand binding stats  NGF_1 ..                     | | |       | |                      *^***********^            |  |                    
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                     | | |       | |                       |  |*****                |  |                    
search RasMol script viewer Motif-ligand binding stats  asxturn ..                     *** |       | |                       |  ||  |                 |  |                    
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       | |       | |                       |  |****                 ****                    
search RasMol script viewer Motif-ligand binding stats  nest ..                       ***       | |                       |  |                                             
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ***                       ****                                             

   New search    1bnd:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML