triangle PDBeMotif: 1bgo  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.22.38
Classification hydrolase    | release date: Fri, May 29, 1998
Title crystal structure of cysteine protease human cathepsin k in complex with a covalent peptidomimetic inhibitor
Authors A.C.ALLEN, B.ZHAO, C.A.JANSON, D.F.VEBER, D.S.YAMASHITA, H.-J.OH, I.N.UZINSKAS, K.D'ALESSIO, K.F.ERHARD, M.A.LEVY, M.S.MCQUENEY, R.C.HALTIWANGER, R.L.DESJARLAIS, S.S.ABDEL-MEGUID, T.A.TOMASZEK, W.E.BONDINELL, W.W.SMITH
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search I10 I10 binding statistics I10
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CATHEPSIN K
member of: CATH:search3.90.70.10GENE3D:searchG3DSA_3.90.70.10PANTHER:searchPTHR12411/searchPTHR12411_SF55PFAM:searchPF00112PRINTS:searchPAPAINPROSITE PATTERNS:searchPS00139/searchPS00639/searchPS00640, SMART:searchSM00645SUPERFAMILY:searchSSF54001UniProt:searchP43235
JMol viewer RasMol script viewer  I10 300A  ..                  *   * **                                * *  *****                                                                    *                       ***                    *                        *      
sec str:  ..........................hhhhhhhhhhhhhhhhhh.......hhhhhhh.....hhh...hhhhhhhhhh......................hhh.......eee.....hhhhhhhhhhh..eeeee....hhhh..................eeeeeeeeee....eeeeee...........eeeee.....hhh.....eee..
sequence :  ..APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         ||||     || | ||||| | |    | **^* |            || ||| |  |          | |         |||   | | || |||        | ||   |              | ||  || |      |  || ||| |       |    | |    || || | |  |  |     |  | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ||||     || | ||||| | |    |    ^**            || ||| |  |          | |         |||   | | |^**||        | ||   |              | ||  || |      |  || ||| |       |    | |    || || | |  |  |     |  | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         ||||     || | ||||| | |    |    | |            |^***| |  |          | |         |||   | | |  |||        | ||   |              | ||  || |      |  || ||| |       |    | |    |^*** | |  |  |     |  | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         ||||     |^*****||| | ^*****    | |            |  ||^*****          | |         |^***** | |  |||        | ^*****              | ||  || |      |  || ||| |       ^***** |    |  |  | |  |  |     |  | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_CYS ..         ||||     ******^*****           | |            |  ||  |             | |         | |   | | |  |||        |  |                  | ||  || |      |  || ||| |       |      |    |  |  | |  |  |     |  | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_HIS ..         ||||     || | ||||| |           | |            |  ||  |             | |         | |   | | |  |||        |  |                  | ||  || |      |  || ||**^********      |    |  |  | |  |  |     |  | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_ASN ..         ||||     || | ||||| |           | |            |  ||  |             | |         | |   | | |  |||        |  |                  | ||  || |      |  || ||| |              *****^**************     |  | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         ||||     || | ***** |           | |            |  ||  |             | |         | |   | | |  |||        |  |                  | |***** |      |  || ||| |                   |  |  | |  |        |  | |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         ||||     || | ||||  |           | |            |  ||  |             | |         | |   | | |  |||        |  |                  | ||  |  |      |  |***** |                   |  |  | |  |        |  | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..         ||||     || | ||||  |           | |            |  ||  |             | |         | |   | | |  |||        |  |                  ***|  |  |      |  |***|  |                   |  |  | |  |        |  | |        
search RasMol script viewer Motif-ligand binding stats  betabulge ..         ||||     || | ||||  |           | |            |  ||  |             | |         | |   | | |  |**        |  |                  |  |  |  |      |  ||  |  |                   |  |  | |  |        |  | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ||||     || | ****  |           | |            ********             | |         | |   | | |  |          ****                  |  ****  |      |  |****  |                   |  |  | ****        **** |        
search RasMol script viewer Motif-ligand binding stats  nest ..         ****     || |  ||   |           ***                                 ***         ***   | | |  |          |  |                  |  |  |  |      |  |      |                   |  |  |                ***        
search RasMol script viewer Motif-ligand binding stats  niche ..          ***     |***  ||   |                                                                 *** ****          ****                  ****  ****      ****      |                   |  ****                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  |     |*****                                                                                                                                   |                   |                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  *     *                                                                                                                                        *                   *                                 

   New search    1bgo:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML