triangle PDBeMotif: 1bgb  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.1.21.4
Classification hydrolase/dna    | release date: Thu, May 28, 1998
Title ecorv endonuclease complex with 5'-cgggatatccc dna
Authors J.PERONA, N.C.HORTON
Method X-RAY DIFFRACTION (resolution: 2.00Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPS
EPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRVATRKSSLKTYNINELNEIPK
PYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIY
RGRK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ECORV ENDONUCLEASE
member of: CATH:search3.40.600.10GENE3D:searchG3DSA_3.40.600.10PFAM:searchPF09233PIRSF:searchPIRSF000995SUPERFAMILY:searchSSF52980UniProt:searchP04390
sec str:  ...hhhhhhhhhhhhhhh....eee....eeee....hhhhhhhhhhhhhhhhhhhhhh...eee..........eeee.hhh...eeeeeeeeeee............................hhheeeeeeeeeeee.....eeehhh...........eeeeeehhhh...................hhhhhh.......hhhhhhhhh.....hhhh......hhhhhhhhhh...
sequence :  ..SLRSDLINALYDENQKYDVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTNKENEKIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRV..KTYNINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       ..149       159       169       179       189       199       209       219       229       239    
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |                 |  | |||    | |     | ||  |     |    | |      |  |       |  |             | || |      |   || |^*** |   |  |             ..|  || ||  |              |  |    | |^*** |    |     | || | || ||   |  |            ^***   || ||||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |                 |  | |||    | |     | ||  |     |    | |      |  |       |  |             | || |      |   || || || |   |  |             ..|  || ||  |              |  |    | | ||| |    |     | || | || ||   |  |                   || ||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**                 |  | |||    | |     | ||  |     |    | |      |  |       |  |             ^**| |      |   || || || |   |  |             ..*  || ||  |              |  |    | | ||| |    |     | || | || ||   |  |                   || ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..                    |  | |||    | |     ^***  |     |    | |      |  |       |  |             ^*** |      |   || || || |   |  |             ..   || ||  |              |  |    | | ||| |    |     | || | ^***|   |  |                   || ||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..                    |  | |||    | |       |   |     *******^      |  |       |  |               |  |      |   || || || |   |  |             ..   || ||  |              |  |    | | ||| |    |     | || | ||  |   |  |                   || ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                    ^*****||    | |       |   |          | |      |  |       |  |               |  |      ^***** || || |   |  |             ..   || ||  |              |  |    ^*****| ^*****     | |^*****  |   |  |                   || ||||
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                       | |||    | |       |   |          | |      |  |       |  |               |  |          || || || |   |  |             ..   || ||  |              |  |      | |||            | || | |   |   |  |                   || ^***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                       | |||    | |       |   |          | |      |  |       |  |               |  |          ***** || |   |  |             ..   || ||  |              |  |      | |||            | || | |   |   |  |                   || ||| 
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                       *****    | |       |   |          | |      |  |       |  |               |  |          || || || |   |  |             ..   || ||  |              |  |      | |||            | || | |   |   |  |                   || ||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..                       ****|    | |       |   |          | |      |  |       ****               |  |          ******** |   |  |             ..   *****  |              |  |      ****|            | || | |   |   |  |                   |****| 
search RasMol script viewer Motif-ligand binding stats  nest ..                       | ***    | |       |   |          ***      |  |                          |  |           |  | || |   |  |             ..       |  |              |  |        ***            ***| | |   |   |  |                   |  *** 
search RasMol script viewer Motif-ligand binding stats  niche ..                       | | |    ***       |   |                   ****                          ****           *********   ****             ..       ****              ****                          *** |   |   ****                   |    | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                       | | |              |   |                                                                                             ..                                                           |   |                          ****** 
search RasMol script viewer Motif-ligand binding stats  stmotif ..                       *****              |   |                                                                                             ..                                                           *****                                 
search RasMol script viewer Motif-ligand binding stats  ststaple ..                       | |                *****                                                                                             ..                                                                                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                       ***                                                                                                                  ..                                                                                                 

chain B : ECORV ENDONUCLEASE
member of: CATH:search3.40.600.10GENE3D:searchG3DSA_3.40.600.10PFAM:searchPF09233PIRSF:searchPIRSF000995SUPERFAMILY:searchSSF52980UniProt:searchP04390
sec str:  ...hhhhhhhh.............eee.....hhhhhhhhhhhhhhhhhhhhhh...eee..........eeee.......eeeeeeeeeee..........................hhheeeeeeeeeeeee......eee..........eeeeeeeeeehhhh...................hhhhhh.......hhhhhhhhh.....hhhh......hhhhhhhhh....
sequence :  ..SLRSDLINAL..DVCGIISAEGKIYPLGSDTKVLSTIFELFSRPIINKIAEKHGYIVEEPKQQNHYPDFTLYKPSEPNKKIAIDIKTTYTN..KIKFTLGGYTSFIRNNTKNIVYPFDQYIAHWIIGYVYTRV..SLKTYNINELNEIPKPYKGVKVFLQDKWVIAGDLAGSGNTTNIGSIHAHYKDFVEGKGIFDSEDEFLDYWRNYERTSQLRNDKYNNISEYRNWIYRGRK
seq num:  ..2         ..19        29        39        49        59        69        79        89       ..102       112       122       132       ..147       157       167       177       187       197       207       217       227       237      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..| |       ..   |  | |||            | ||  |     |  | |||    | |              |  |         | ..      |    |  ^***    || ||             ..| |     || ||              |  |    | |^*** |    |  || | || | || |    |  || |         ^***|  || ||||
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..| |       ..   |  | |||            | ||  |     |  | |||    | |              |  |         | ..      |    |  |  |    || ||             ..* |     || ||              |  |    | | ||| |    |  || | || | || |    |  || |         |   |  || ||||
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..^**       ..   |  | |||            | ||  |     |  | |||    | |              |  |         ^*..      |    |  |  |    || ||             ..^**     || ||              |  |    | | ||| |    |  || | || | || |    |  || |         |   |  || ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..          ..   |  | |||            ^***  |     |  | |||    | |              |  |         ^*..      |    |  |  |    || ||             ..        || ||              |  |    | | ||| |    |  || | || | ^***    |  || |         |   |  || ||||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..          ..   |  | |||              |   |     *******^    | |              |  |           ..      |    |  |  |    || ||             ..        || ||              |  |    | | ||| |    |  || | || |  |      |  || |         |   |  || ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..          ..   ^*****||              |   |        | |||    | |              |  |           ..      ^*****  |  |    || ||             ..        || ||              |  |    ^*****| ^*****  || | |^*****      |  || |         |   |  || ||||
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..          ..      | |||              |   |        | |||    | |              |  |           ..           |  |  |    || ||             ..        || ||              |  |      | |||      |  || | || |         |  || |         |   |  || ^***
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..          ..      | |||              |   |        | |||    | |              |  |           ..           |  |  |    || ||             ..        || ||              |  |      | |||      ***** | || |         |  || |         |   |  || ||| 
search RasMol script viewer Motif-ligand binding stats  asxmotif ..          ..      | |||              |   |        | |||    | |              |  |           ..           |  |  |    || ||             ..        || ||              |  |      | |||      |  |  | || |         |  || |         *****  || ||| 
search RasMol script viewer Motif-ligand binding stats  betaturn ..          ..      ****|              |   |        ****|    | |              |  |           ..           |  |  |    ****|             ..        ****|              |  |      ****|      ****  | || |         |  || |                |****| 
search RasMol script viewer Motif-ligand binding stats  nest ..          ..        ***              |   |          ***    | |              |  |           ..           |  |  |     |  |             ..         |  |              |  |        ***            ***| |         |  || |                |  *** 
search RasMol script viewer Motif-ligand binding stats  niche ..          ..                         |   |                 ***              ****           ..           *******     ****             ..         ****              ****                          ***         *******                |    | 
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..          ..                         |   |                                                 ..                                        ..                                                                                            ****** 
search RasMol script viewer Motif-ligand binding stats  ststaple ..          ..                         *****                                                 ..                                        ..                                                                                                   

chain C : DNA (5'-D(*CP*GP*GP*GP*AP*TP*AP*TP*CP*CP*C)-3')
sec str:  .............
sequence :  ..CGGGATATCCC
seq num:  ..801        

chain D : DNA (5'-D(*CP*GP*GP*GP*AP*TP*AP*TP*CP*CP*C)-3')
sec str:  ............
sequence :  ..GGGATATCCC
seq num:  ..902       

   New search    1bgb:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML