triangle PDBeMotif: 1bbr  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.21.5
Classification serine protease    | release date: Mon, Apr 27, 1992
Title the structure of residues 7-16 of the a alpha chain of human fibrinogen bound to bovine thrombin at 2.3 angstroms resolution
Authors B.EDWARDS, P.MARTIN
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains L,J,M sequence:
TSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
Chain H sequence:
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISM
LDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT
Chain E sequence:
SVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEG
CDRDGKYGFYTHVFRLKKWIQKVIDRLGS
Chains F,G,I sequence:
DFLAEGGGVR
Chains K,N sequence:
IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISM
LDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVL
QVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFY
THVFRLKKWIQKVIDRLGS
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain L : EPSILON-THROMBIN
member of: CATH:search4.10.140.10GENE3D:searchG3DSA_2.40.20.10/searchG3DSA_4.10.140.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00051/searchPF09396PIRSF:searchPIRSF001149PROSITE PROFILES:searchPS50070, SMART:searchSM00130SUPERFAMILY:searchSSF57440UniProt:searchP00735
sec str:  .........................hhhhhhhhh....
sequence :  ..TFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
seq num:  ..1         3         13        14    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   ||| ||  |  | |   ^**|   |  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   ||| ||  |  | |   ^***   ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****| ||  |  | |                
search RasMol script viewer Motif-ligand binding stats  betaturn ..      |*********** |                
search RasMol script viewer Motif-ligand binding stats  nest ..      ||| |      ***                
search RasMol script viewer Motif-ligand binding stats  niche ..      *****                         

chain H : EPSILON-THROMBIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00089PIRSF:searchPIRSF001149PRINTS:searchCHYMOTRYPSIN/searchPROTHROMBINPROSITE PATTERNS:searchPS00134, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
JMol viewer RasMol script viewer  ACE 308F  ..                                                                                             *                                                        
sec str:  ..........................................hhhh...hhhh...hhh................................................................hhhhhhhhh....................
sequence :  ..IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTT
seq num:  ..16        26        36        45        55        60        66        76        85        95        104       114       124       131       141       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | |  |      |  |        | || |   ||   | |||^*** ||  |  |   |  | | |  |  |    |  |        |      |     | ||      | |               | | | ||   
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | |  |      |  |        | || |   ||   | |||  || ||  |  |   |  | | |  |  |    |  |        |      |     | ||      | |               | | **^*   
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | |  |      |  |        ^**| |   ||   | |||  || ||  |  |   |  | | |  |  |    |  |        |      |     | ||      | |               | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | |  |      ^***        |  | |   ||   | |||  ^***|  |  |   ^*** | |  ^***    |  |        |      |     | ||      | |               | |        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | |  |                  |  | |   ||   | |||  || ||  |  |        | |          |  |        |      ********^|      | |               | |        
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..         | |  |                  |  | ****^*   | |||  || ||  |  |        | |          |  |        |            |  |      | |               | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |  |                  |  |     |    | |||  || ||  |  |        | |          |  |        |            |  |      ***               | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |  |                  |  |     |    ****|  ****|  |  |        | |          |  |        |            |  |                        | |        
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |                  |  |     |      ***   |  |  |  |        | |          |  |        |            |  |                        | |        
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                  ****     |            ****  ****        ***          ****        |            ****                        ***        
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                          *                                                       *                                                   

chain E : EPSILON-THROMBIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00089PIRSF:searchPIRSF001149PRINTS:searchCHYMOTRYPSIN/searchPROTHROMBINPROSITE PATTERNS:searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
sec str:  ....................hhhhhhhhh.............hhhhh...............................................hhhhhhhhhhhhh....
sequence :  ..SVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
seq num:  ..149       156       166       176       185       191       201       209       220       229       239      
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..| || |                 | ^**|  |  |     |  | || | |||||||  |               |  ||  |  |      |  ||            
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..^*** |                 |  | |  |  |     |  | || | |||||||  |               ^***|  |  |      |  ||            
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  |  |                 |  | |  |  |     |  ^*** | |||||||  |                   |  |  |      |  ||            
search RasMol script viewer Motif-ligand binding stats  RGD ..  |  |                 |  | |  |  |     |  | |*** |||||||  |                   |  |  |      |  ||            
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..  |  |                 |  | |  |  |     |  | |  ******^*****                   |  |  |      |  ||            
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  |  |                 |  | |  |  |     |  | |    |||||||                      |  |  |      *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****                 |  | |  |  |     **** |    *******                      |  |  |      ****             
search RasMol script viewer Motif-ligand binding stats  nest ..  |  |                 |  | |  |  |        ***    ||***||                      |  |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..  ****                 ******  ****               ||*****                      *******                       
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                  ******                                                     

chain F : FIBRINOGEN ALPHA/ALPHA-E CHAIN PRECURSOR
member of: PANTHER:searchPTHR19143/searchPTHR19143_SF172UniProt:searchP02671
JMol viewer RasMol script viewer  ACE 308F  ..**        
sec str:  ............
sequence :  ..DFLAEGGGVR
seq num:  ..309       
search RasMol script viewer Motif-ligand binding stats  nest ..    ***   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain J : EPSILON-THROMBIN
member of: CATH:search4.10.140.10GENE3D:searchG3DSA_4.10.140.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF09396PIRSF:searchPIRSF001149PRINTS:searchPROTHROMBINSMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
sec str:  .........................hhhhhhhhhhh..
sequence :  ..TFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
seq num:  ..1         3         13        14    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   ||| |      | |   ^**| | ||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   ||| |      | |   ^*** | ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****| |      | |   |  | |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ||| |      | |   |  | *****   
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ||| |      | |   **** ****    
search RasMol script viewer Motif-ligand binding stats  nest ..      ||| |      ***                
search RasMol script viewer Motif-ligand binding stats  niche ..      *****                         

chain K : EPSILON-THROMBIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00089PIRSF:searchPIRSF001149PRINTS:searchCHYMOTRYPSIN/searchPROTHROMBINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
JMol viewer RasMol script viewer  ACE 308G  ..                                                                                                                                                                                                                                                                   
sec str:  ..........................................hhhh...hhhh......................................................................hhhhhhhhh......................................hhhhhhhhh.................................................................hhhhhhhhhhhhh....
sequence :  ..IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
seq num:  ..16        26        36        45        55        60        66        76        85        95        104       114       124       131       141       149       156       166       176       185       191       201       209       220       229       239      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | |  |      || |        | || |   || ||| |||^***||   |  | | || ||  |  |  ||   |  || |     |      |     | ||      |   |    |  |     | | |||| | |  | |            |  ||| ||||  | ||     |  | || | |||||||  |     | |   ||  |  ||  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | |  |      || |        | || |   || ||| |||  | ||   |  | | || ||  |  |  ||   |  || |     |      |     | ||      |   |    |  |     | | **^* | |  | |            |  ||| ||||  | ||     |  | || | |||||||  |     | |   ||  |  ||  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | |  |      || |        ^**| |   || ||| |||  | ||   |  | | || ||  |  |  ||   |  || |     |      |     | ||      |   |    |  |     | |  | | | |  | |            |  ||| ^**|  | ||     |  | || | |||||||  |     | |   ||  |  ||  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | |  |      ^***        |  | |   || ||| |||  ^***   |  | | ^***|  |  ^***|   |  || |     |      |     | ||      |   |    |  |     | |  | | | ^*** |            |  |||  | |  | ||     |  | || | |||||||  |     | |   ||  ^***|  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | |  |       | |        |  | |   || ||| |||  | |    |  | |  |  |  |     ||   |  || |     |      ********^|      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | || | |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         | |  |       | |        |  | |   || ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  ^*** | |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  RGD ..         | |  |       | |        |  | |   || ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | |*** |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..         | |  |       | |        |  | ****^* ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | |  | |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | |  ******^*****     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            *****|  | |  | ||     |  | |    |||||||        | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      *****    |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  |***     |            | ||               |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     **   |  |        |            | ||               |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |   **      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         | |  |       | |        |  |     |  |******  | |    |  | |  |  |  |          |  |        |            | ||               |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |           |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |  |       | |        |  |     |  | ****|  | |    |  | |  |  |  |          |  |        |            | ||               ****     | |  | | | |  | |            **** |  | |  | ||     **** |    ****|||        | |           |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |  |       | |        |  |     |  |   | |  | |    |  | |  |  |  |          |  |        |            | ||               |  |     | |  | | ***  | |                 |  | |  | ||        | |    |||||||        ***           |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |       | |        |  |     |  |   ***  | |    |  | |  |  |  |          |  |        |            | ||               |  |     | |  | |      | |                 |  | |  | ||        ***    ||***||                      |  |  |                  ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           ****       ***        ****     ****        | |    **** ****  ****          ****        |            ****               ****     ***  ***      ***                 ******  ****               ||*****                      *******                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          |           ***                                         |            ***                                                                   ***                ||||||                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                          *                                                       *                                                                                                     ******                                                     

chain G : FIBRINOGEN ALPHA/ALPHA-E CHAIN PRECURSOR
member of: PANTHER:searchPTHR19143/searchPTHR19143_SF172UniProt:searchP02671
JMol viewer RasMol script viewer  ACE 308G  ..*         
sec str:  .........ee.
sequence :  ..DFLAEGGGVR
seq num:  ..309       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****|   
search RasMol script viewer Motif-ligand binding stats  nest ..    ***   

Assembly 3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain M : EPSILON-THROMBIN
member of: CATH:search4.10.140.10GENE3D:searchG3DSA_4.10.140.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF09396PIRSF:searchPIRSF001149PRINTS:searchPROTHROMBINSMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
sec str:  ................hhhhh....hhhhhhhh.....
sequence :  ..TFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
seq num:  ..1         3         13        14    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | || ||  || |||   ^**| |||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | || ||  || |||   ^*** ||^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****| ||  || |||     |  |||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | || ||  || |||     *****|  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     **** |********|     **** |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     | || |   |  ***          |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ******   |    |          ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              ******                

chain N : EPSILON-THROMBIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00089PIRSF:searchPIRSF001149PRINTS:searchCHYMOTRYPSIN/searchPROTHROMBINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
JMol viewer RasMol script viewer  ACE 308I  ..                                                                                             *                                                                                                                                                                     
sec str:  ..........................................hhhh...hhhh...hhh................................................................hhhhhhhhh......................................hhhhhhh...................................................................hhhhhhhhhhhhh....
sequence :  ..IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
seq num:  ..16        26        36        45        55        60        66        76        85        95        104       114       124       131       141       149       156       166       176       185       191       201       209       220       229       239      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||  |      |  |        | || |   || | | |||^*** ||  |  | | || ||  |  |  |    |  |        |      |     | ||           |  ||  |     | | | ||   |  | |                 | ||||  | ||        | || | |||||||  |           ||  |  |   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |||  |      |  |        | || |   || | | |||  || ||  |  | | || ||  |  |  |    |  |        |      |     | ||           |  ||  |     | | **^*   |  | |                 | ||||  | ||        | || | |||||||  |           ||  |  |   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||  |      |  |        ^**| |   || | | |||  || ||  |  | | || ||  |  |  |    |  |        |      |     | ||           |  ||  |     | |        |  | |                 | ^**|  | ||        | || | |||||||  |           ||  |  |   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||  |      ^***        |  | |   || | | |||  ^***|  |  | | ^***|  |  ^***    |  |        |      |     | ||           |  ||  |     | |        ^*** |                 |  | |  | ||        | || | |||||||  |           ||  ^***   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       | |||  |                  |  | |   || | | |||  || ||  |  | |  |  |  |          |  |        |      ********^|           |  ||  |     | |           | |                 |  | |  | ||        | || | |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | |||  |                  |  | |   || | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        ^*** | |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  RGD ..       | |||  |                  |  | |   || | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |*** |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..       | |||  |                  |  | ****^* | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |  | |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..       | |||  |                  |  |     |  | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |  ******^*****           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||  |                  |  |     |  | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |    |||||||              ||         |  |     *********         
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |||  |                  |  |     |  | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |    |||||||              **         |  |     || ||  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |                  |  |     |  | ****|  ****|  |  | |  |  |  |          |  |        |            |  |           |  |****     | |           | |                 |  | |  | ||        | |    ****|||                         |  |     ********          
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |                  |  |     |  |   ***   |  |  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           ***                 |  | |  | ||        ***    ||***||                         |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                  ****     ****         ****  **** ****  ****          ****        |            ****           ********     ***           ***                 ******  ****               ||*****                         ****                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          |                                                       |                                                                                  ***                ||||||                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                          *                                                       *                                                                                                     ******                                                     

chain I : FIBRINOGEN ALPHA/ALPHA-E CHAIN PRECURSOR
member of: PANTHER:searchPTHR19143/searchPTHR19143_SF172UniProt:searchP02671
JMol viewer RasMol script viewer  ACE 308I  ..*         
sec str:  ..hhhhhh....
sequence :  ..DFLAEGGGVR
seq num:  ..309       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..***** |   
search RasMol script viewer Motif-ligand binding stats  nest ..    ***   

Assembly 4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain J : EPSILON-THROMBIN
member of: CATH:search4.10.140.10GENE3D:searchG3DSA_4.10.140.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF09396PIRSF:searchPIRSF001149PRINTS:searchPROTHROMBINSMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
sec str:  .........................hhhhhhhhhhh..
sequence :  ..TFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
seq num:  ..1         3         13        14    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |   ||| |      | |   ^**| | ||||  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |   ||| |      | |   ^*** | ^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****| |      | |   |  | |  ||   
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ||| |      | |   |  | *****   
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ||| |      | |   **** ****    
search RasMol script viewer Motif-ligand binding stats  nest ..      ||| |      ***                
search RasMol script viewer Motif-ligand binding stats  niche ..      *****                         

chain K : EPSILON-THROMBIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00089PIRSF:searchPIRSF001149PRINTS:searchCHYMOTRYPSIN/searchPROTHROMBINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
JMol viewer RasMol script viewer  ACE 308I  ..                                                                                                                                                                                                                                                                   
JMol viewer RasMol script viewer  ACE 308G  ..                                                                                                                                                                                                                                                                   
sec str:  ..........................................hhhh...hhhh......................................................................hhhhhhhhh......................................hhhhhhhhh.................................................................hhhhhhhhhhhhh....
sequence :  ..IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
seq num:  ..16        26        36        45        55        60        66        76        85        95        104       114       124       131       141       149       156       166       176       185       191       201       209       220       229       239      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..         | |  |      || |        | || |   || ||| |||^***||   |  | | || ||  |  |  ||   |  || |     |      |     | ||      |   |    |  |     | | |||| | |  | |            |  ||| ||||  | ||     |  | || | |||||||  |     | |   ||  |  ||  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         | |  |      || |        | || |   || ||| |||  | ||   |  | | || ||  |  |  ||   |  || |     |      |     | ||      |   |    |  |     | | **^* | |  | |            |  ||| ||||  | ||     |  | || | |||||||  |     | |   ||  |  ||  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         | |  |      || |        ^**| |   || ||| |||  | ||   |  | | || ||  |  |  ||   |  || |     |      |     | ||      |   |    |  |     | |  | | | |  | |            |  ||| ^**|  | ||     |  | || | |||||||  |     | |   ||  |  ||  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         | |  |      ^***        |  | |   || ||| |||  ^***   |  | | ^***|  |  ^***|   |  || |     |      |     | ||      |   |    |  |     | |  | | | ^*** |            |  |||  | |  | ||     |  | || | |||||||  |     | |   ||  ^***|  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..         | |  |       | |        |  | |   || ||| |||  | |    |  | |  |  |  |     ||   |  || |     |      ********^|      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | || | |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..         | |  |       | |        |  | |   || ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  ^*** | |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  RGD ..         | |  |       | |        |  | |   || ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | |*** |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..         | |  |       | |        |  | ****^* ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | |  | |||||||  |     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            |  |||  | |  | ||     |  | |  ******^*****     | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      |   |    |  |     | |  | | | |  | |            *****|  | |  | ||     |  | |    |||||||        | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  || |     |            | ||      *****    |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     ||   |  |***     |            | ||               |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |   ||      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  betabulge ..         | |  |       | |        |  |     |  ||| |||  | |    |  | |  |  |  |     **   |  |        |            | ||               |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |   **      |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..         | |  |       | |        |  |     |  |******  | |    |  | |  |  |  |          |  |        |            | ||               |  |     | |  | | | |  | |            |  | |  | |  | ||     |  | |    |||||||        | |           |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |  |       | |        |  |     |  | ****|  | |    |  | |  |  |  |          |  |        |            | ||               ****     | |  | | | |  | |            **** |  | |  | ||     **** |    ****|||        | |           |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         | |  |       | |        |  |     |  |   | |  | |    |  | |  |  |  |          |  |        |            | ||               |  |     | |  | | ***  | |                 |  | |  | ||        | |    |||||||        ***           |  |  |                  | |  
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |       | |        |  |     |  |   ***  | |    |  | |  |  |  |          |  |        |            | ||               |  |     | |  | |      | |                 |  | |  | ||        ***    ||***||                      |  |  |                  ***  
search RasMol script viewer Motif-ligand binding stats  niche ..           ****       ***        ****     ****        | |    **** ****  ****          ****        |            ****               ****     ***  ***      ***                 ******  ****               ||*****                      *******                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          |           ***                                         |            ***                                                                   ***                ||||||                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                          *                                                       *                                                                                                     ******                                                     

chain G : FIBRINOGEN ALPHA/ALPHA-E CHAIN PRECURSOR
member of: PANTHER:searchPTHR19143/searchPTHR19143_SF172UniProt:searchP02671
JMol viewer RasMol script viewer  ACE 308G  ..*         
sec str:  .........ee.
sequence :  ..DFLAEGGGVR
seq num:  ..309       
search RasMol script viewer Motif-ligand binding stats  betaturn ..  ****|   
search RasMol script viewer Motif-ligand binding stats  nest ..    ***   

chain M : EPSILON-THROMBIN
member of: CATH:search4.10.140.10GENE3D:searchG3DSA_4.10.140.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF09396PIRSF:searchPIRSF001149PRINTS:searchPROTHROMBINSMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
sec str:  ................hhhhh....hhhhhhhh.....
sequence :  ..TFGAGEADCGLRPLFEKKQVQDQTEKELFESYIEGR
seq num:  ..1         3         13        14    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | || ||  || |||   ^**| |||  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | || ||  || |||   ^*** ||^***  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^*****| ||  || |||     |  |||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | || ||  || |||     *****|  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..     **** |********|     **** |  |  
search RasMol script viewer Motif-ligand binding stats  nest ..     | || |   |  ***          |  |  
search RasMol script viewer Motif-ligand binding stats  niche ..     ******   |    |          ****  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..              ******                

chain N : EPSILON-THROMBIN
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24254/searchPTHR24254_SF8PFAM:searchPF00089PIRSF:searchPIRSF001149PRINTS:searchCHYMOTRYPSIN/searchPROTHROMBINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP00735
JMol viewer RasMol script viewer  ACE 308I  ..                                                                                             *                                                                                                                                                                     
sec str:  ..........................................hhhh...hhhh...hhh................................................................hhhhhhhhh......................................hhhhhhh...................................................................hhhhhhhhhhhhh....
sequence :  ..IVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDYIHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCKASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDRLGS
seq num:  ..16        26        36        45        55        60        66        76        85        95        104       114       124       131       141       149       156       166       176       185       191       201       209       220       229       239      
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       | |||  |      |  |        | || |   || | | |||^*** ||  |  | | || ||  |  |  |    |  |        |      |     | ||           |  ||  |     | | | ||   |  | |                 | ||||  | ||        | || | |||||||  |           ||  |  |   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..       | |||  |      |  |        | || |   || | | |||  || ||  |  | | || ||  |  |  |    |  |        |      |     | ||           |  ||  |     | | **^*   |  | |                 | ||||  | ||        | || | |||||||  |           ||  |  |   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||  |      |  |        ^**| |   || | | |||  || ||  |  | | || ||  |  |  |    |  |        |      |     | ||           |  ||  |     | |        |  | |                 | ^**|  | ||        | || | |||||||  |           ||  |  |   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       | |||  |      ^***        |  | |   || | | |||  ^***|  |  | | ^***|  |  ^***    |  |        |      |     | ||           |  ||  |     | |        ^*** |                 |  | |  | ||        | || | |||||||  |           ||  ^***   |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       | |||  |                  |  | |   || | | |||  || ||  |  | |  |  |  |          |  |        |      ********^|           |  ||  |     | |           | |                 |  | |  | ||        | || | |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       | |||  |                  |  | |   || | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        ^*** | |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  RGD ..       | |||  |                  |  | |   || | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |*** |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..       | |||  |                  |  | ****^* | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |  | |||||||  |           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..       | |||  |                  |  |     |  | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |  ******^*****           ||         |  |     || ||| ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       | |||  |                  |  |     |  | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |    |||||||              ||         |  |     *********         
search RasMol script viewer Motif-ligand binding stats  betabulge ..       | |||  |                  |  |     |  | | |||  || ||  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           | |                 |  | |  | ||        | |    |||||||              **         |  |     || ||  |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..       ****|  |                  |  |     |  | ****|  ****|  |  | |  |  |  |          |  |        |            |  |           |  |****     | |           | |                 |  | |  | ||        | |    ****|||                         |  |     ********          
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |                  |  |     |  |   ***   |  |  |  | |  |  |  |          |  |        |            |  |           |  ||  |     | |           ***                 |  | |  | ||        ***    ||***||                         |  |                       
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                  ****     ****         ****  **** ****  ****          ****        |            ****           ********     ***           ***                 ******  ****               ||*****                         ****                       
search RasMol script viewer Motif-ligand binding stats  stturn ..                                          |                                                       |                                                                                  ***                ||||||                                                     
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                          *                                                       *                                                                                                     ******                                                     

chain I : FIBRINOGEN ALPHA/ALPHA-E CHAIN PRECURSOR
member of: PANTHER:searchPTHR19143/searchPTHR19143_SF172UniProt:searchP02671
JMol viewer RasMol script viewer  ACE 308I  ..*         
sec str:  ..hhhhhh....
sequence :  ..DFLAEGGGVR
seq num:  ..309       
search RasMol script viewer Motif-ligand binding stats  asxmotif ..***** |   
search RasMol script viewer Motif-ligand binding stats  nest ..    ***   

   New search    1bbr:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML