triangle PDBeMotif: 1ba4  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification glycoprotein    | release date: Tue, Apr 7, 1998
Title the solution structure of amyloid beta-peptide (1-40) in a water-micelle environment. is the membrane-spanning domain where we think it is? nmr, 10 structures
Authors A.A.WATSON, D.J.CRAIK, D.P.FAIRLIE, M.COLES, W.BICKNELL
Method SOLUTION NMR
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Residue colours:  hydrophilic   hydrophobic   intermediate 
1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | |||   |  || | ||^** |  |    |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ^***|   |  || | ||||| |  |    |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         | |   |  || | |^*****  ^*****  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |   ***** | *****            
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |   ****  | ****             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         ***         |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****              

2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  |  |          |  |^** |  |    |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |  ^***          |  ||   |  |    |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |                |  ^*****  ^*****  
search RasMol script viewer Motif-ligand binding stats  nest ..  ***                |   |              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                     *****              

3     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     | |  |  | |  ||   ||^** |  ||  ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     | ^***  | |  ||   || |  |  ||  ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     | |     | |  ||   |^*****  ^*****||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..     | |     | *****   |  |      |  ||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..     | |     | ****    ****      ****|||
search RasMol script viewer Motif-ligand binding stats  gammaturn ..     ***     | |                    ||||
search RasMol script viewer Motif-ligand binding stats  nest ..             ***                    ****

4     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||||  ||| |  | |  ||    |^** ||||    |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||||  |^***  | |  ||    |  | ||||    |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..||||  | |    | |  ||    ^*****||^*****  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..||||  | |    | *****       *****        
search RasMol script viewer Motif-ligand binding stats  asxturn ..***|  | |    | |  |        |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn .. | |  | |    | ****        ****         
search RasMol script viewer Motif-ligand binding stats  gammaturn .. | |  ***    | |                        
search RasMol script viewer Motif-ligand binding stats  nest .. ***         ***                        

5     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  |       |  ||||^** ||||    |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ^***       |  |||| || ||||    |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                  |  |||^*****||^*****  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                  *****|  |*****        
search RasMol script viewer Motif-ligand binding stats  betaturn ..                  **** ********         

6     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  |             |^**|| ||    | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ^***             |   || ||    | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                        ^***** |^***** |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                            *****    | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                            ****     | |
search RasMol script viewer Motif-ligand binding stats  nest ..                                     ***

7     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | |  | ||       |  || |^**|| ||| |||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | |  ^***       |  || ||  || ||| |||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | |  | |        |  || ^***** |^*****||
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | |  | |        *****  |  *****| |||||
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | |  | |        ****   *******|****|||
search RasMol script viewer Motif-ligand binding stats  nest ..  ***  ***                      |  *****
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                ******  

8     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       | ||             |^** |  |    |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ^***             |    |  |    |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       | |              ^*****  ^*****  
search RasMol script viewer Motif-ligand binding stats  nest ..       ***                              

9     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  | | ||  |   |  |     ||^** |  |    | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  | | |^***   |  |     || || |  |    | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  | | |       |  |     |^*****  ^***** |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..  | | |       |  |     *****         | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..  | | |       ****     ****          | |
search RasMol script viewer Motif-ligand binding stats  nest ..  *** |                              ***
search RasMol script viewer Motif-ligand binding stats  niche ..    ***                                 

10     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : AMYLOID BETA-PEPTIDE
member of: CATH:search4.10.230.10GENE3D:searchG3DSA_4.10.230.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF03494PRINTS:searchAMYLOIDA4/searchBETAAMYLOIDUniProt:searchP05067
sec str:  ................hhhhhhhhhhhhhhhhhhhhhh....
sequence :  ..DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
seq num:  ..1         11        21        31        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       |  |             |^** |  |   ||||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ^***             |    |  |   ||||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                        ^*****  ^*****||
search RasMol script viewer Motif-ligand binding stats  nest ..                                    ****

   New search    1ba4:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML