triangle PDBeMotif: 1b0p  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   1.2.7.1
Classification oxidoreductase    | release date: Thu, Nov 12, 1998
Title crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus
Authors A.VOLBEDA, E.CHABRIERE, M.H.CHARON
Method X-RAY DIFFRACTION (resolution: 2.31Å)
PDBe Citation   
Small molecules:    search MG MG binding statistics MG   search SF4 SF4 binding statistics SF4   search CA CA binding statistics CA   search TPP TPP binding statistics TPP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALT
TTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAI
ESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPG
IVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASA
KVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGT
SLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLV
NRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINM
IMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKN
VVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANF
TALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQF
QEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNM
SMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFG
GDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVS
MGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPD
GSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTP
MMARPDSGEACDQNRAGTSEQQGDLSKRTKK
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
member of: CATH:search3.30.70.20/search3.40.50.920/search3.40.50.970/search3.40.920.10/search4.10.780.10/search4.10.790.10GENE3D:searchG3DSA_3.30.70.20/searchG3DSA_3.40.50.920/searchG3DSA_3.40.50.970/searchG3DSA_3.40.920.10/searchG3DSA_4.10.780.10/searchG3DSA_4.10.790.10PANTHER:searchPTHR32154/searchPTHR32154_SF0PFAM:searchPF00037/searchPF01558/searchPF01855/searchPF02775/searchPF10371PIRSF:searchPIRSF000159PROSITE PATTERNS:searchPS00198, PROSITE PROFILES:searchPS51379, SMART:searchSM00890SUPERFAMILY:searchSSF52518/searchSSF52922/searchSSF53323/searchSSF54862TIGRFAMS:searchTIGR02176UniProt:searchP94692
JMol viewer RasMol script viewer  SF4 1235B  ..                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                 *                             
JMol viewer RasMol script viewer  TPP 1236A  ..                          ***                                 *                       *   *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    *                    ***                            **                                                                                           ****   *                     * *****                                                                                                                                                                                                             |                             
JMol viewer RasMol script viewer  SF4 1235A  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              *                                                                                                                                                                                                                                                                                                                                                               **  * *                    ||*   *                        ||                                                                                           ||||   |                     * |||||                                                                         **                                                                                                                                  |                             
JMol viewer RasMol script viewer  SF4 1234A  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              *                **  **                                        ** ** *                                                           ||  | |                    |||   |                        ||                                                                                           ||||   |                     | |||||                                                                         ||                                                                                                                                  |                             
JMol viewer RasMol script viewer  SF4 1233A  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | *    ***** *   ||  ||                                 *      || || |   ***   **                                                ||  | |                    |||   |                        ||                                                                                           ||||   |                     | |||||                                                                         ||                                                                                                                                  |                             
JMol viewer RasMol script viewer  CA 1238A  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | |    ||||| |   ||  ||                                 |      || || |   |||   ||                                                ||  | |                    |||   |                        ||                                                                                           ||||   |             * *     | |||||                                                          ** *           ||                                                                                                                                  |                             
JMol viewer RasMol script viewer  MG 1237A  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | |    ||||| |   ||  ||                                 |      || || |   |||   ||                                                ||  | |                    |||   |                        ||                                                                                           |*||   |             | |     * *||||                                                          || |           ||                                                                                                                                  |                             
sec str:  ...eeeeeeehhhhhhhhhhhh..eeee......hhhhhhhhhhhh...........eeee...hhhhhhhhhhhhh.....eeee.hhhhhhhhhhhhhhhh.....eeeeee..............hhhhhh.....eeee...hhhhhhhhhhhhhhhhhh...eeeeee.......eeeeeee.hhhhhhh..hhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeee.....eeeee..hhhhhhhhhhhhhhhh...eeeeee.......hhhhhh.......eeeeee..........hhhhhhhhhhhhh......eeeeee.hhh....hhhhhhhhhhhh......eee........................eeeeeeeee....hhhhhhhhhhhhhhh...eeeeeee........eeeeeeeee..............eeee..hhhh.............eeeee.....hhhhhhh..hhhhhhhhh...eeeee.hhhhhhh.......hhhhhhhhhhh.....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhh.......hhhhh............hhhhh.hhhhh...hhh..hhh..........hhhh.......eeeee.hhh.....hhhhh.....eeeeeeehhh....................eeeeeee.........hhhhh.......eeeeehhhhhhhhhhhhhhhhh............hhhhhh................hhhhhhhhhhhhhheeeee...hhhhhhh................eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh......hhhhhhhhhhhh.......hhhhhhhhhhh....eeeeeeehhhhh...hhhhhhhhh.....eeeeee..................................hhhhhhhh...eeeee.....hhhhhhhhhhhhh....eeeeee...hhh.....hhhhhhhhhhhhh......eee.hhhhhh....eee........hhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhh...................................................hhhhhhhhhhh..
sequence :  ..GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALTTTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGTSLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKNVVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTPMMARPDSGEACDQNRAGTSEQQGDLSKRTKK
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..        |    |   |  |        |   |  |       | ||  |||  ||||  ||||    | ||| |||          |  ||  |   | ||| |    | |       | | | |       | |      |  |              | |          |  |            |  |       ||  | | |||                                    |   | || |     |    |       |  ||  |    || |||                 || ||| |||  |  |   |  |               | |                 |   | |  |^***| | | |  | | |||||   | || | |||||   |    ||||||         ||  | |        ||||  |    |                           |  || |||||  |     | ||| | ||  || |||  |  | |           | |||||   |   |     ||||       ||  ||   |  | | |        |   ||  |     | ||    |  |               ||||  | || || | |   | |  ||||||  |    |  ||||||||  ||||||     || || ||| ^*** | |    | |       |  ||||||||  ||          | ||||       || ||   |  ||  | | |  |      ||||  |        |  |||  |   ^***        | || | ||||||   |  |  |       | ^***            |  || ||   |        |  |   |        | ||||  || |||  |    | |                        | |||     ||||  |||||||||||  |      |  || ||        ||||      |  |        | | ||              |||   |        | | ||||        |  | || |       |||| | |  |        |  |                      |  | |        | |    | ||||   | ||||  || || |  |||||        || || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..        |    |   |  |        |   |  |       | ||  |||  ^**|  ||||    | ||| |||          |  ||  |   | ||| |    ^**       | | | |       | |      |  |              | |          |  |            |  |       ||  | | |||                                    |   ^**^**     |    |       |  ||  |    || |||                 || ||| ^**  |  |   |  |               | |                 |   | |  |  ||| | | |  | | |||||   | || | ^**||   |    ||||||         ||  | |        |^**  |    |                           |  || |||||  |     | ||| | ||  || |||  |  | |           | |||||   |   |     ||||       ||  ||   |  | | |        |   ||  |     ^**|    |  |               ||||  | || || | |   | |  ||||||  |    |  ||||||||  ||||||     || || ||| |||  | |    | |       |  ||||||||  ||          | ^**|       || ||   |  ||  ^** |  |      ||||  |        |  |||  |               | || | ^**|||   |  |  |       |    |            |  || ||   |        |  |   |        | ||||  || |||  |    ^**                        | |||     ||||  |||||^**|||  |      |  |^**|        ||||      |  |        | | ||              |||   |        | | ||||        |  | || |       |||| | |  |        |  |                      |  | |        | |    | ||||   | ||||  || || |  |||||        |^**^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..        |    |   |  |        |   ^***       | ||  |||  ^***  ||||    | ||| |||          |  ||  |   | ||| |      |       | | | |       | |      ^***              | |          ^***            |  |       ||  | | |||                                    |   | |        |    |       ^***^***    || |||                 || |||  |   ^***   |  |               | |                 |   | ^***  ||| | | |  | | |||||   | || | || ||   |    ||||||         ||  | |        | ||  |    |                           |  || |||||  |     | |^*** ||  || |||  |  | |           | |||||   |   |     ||||       ||  ||   |  | | |        |   |^***     ^***    ^***               ||||  | |^*** | |   | ^***|||||  |    |  ||||||||  ||||||     || || ||| ||^*** |    | |       |  ||||||||  ||          | ^***       || ||   |  ||  |   |  |      ||||  |        |  |||  |               | || |  | |||   |  ^***       |    |            |  || ||   |        |  |   |        | ||||  || |||  |                               ^***|     ||||  ||||| |||||  |      |  ||  |        ||||      |  |        | | ||              |||   |        | | ||||        |  | || |       ||^*** |  |        ^***                      |  | |        | |    | ||||   ^***||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..        |    |   |  |        |              | ||  |||   |    ||||    | ||| |||          |  ||  |   | ||| |      |       | | | |       | |                        | |          |  |            |  |       ||  | | |||                                    |   | |        |    |                   || |||                 || |||  |          |  |               | |                 |   |    |  ||| | | |  | | |||||   | || | || ||   |    ||||||         ||  | |        | ||  |    |                           |  || |||||  |     | | |   ||  || |||  |  | |           | |||||   |   |     ||||       ||  ||   |  | | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||  |    |  ||||||||  ||||||     || || ||| |||    *******^       |  ||||||||  ||          |  ||        || ||   |  ||  |   |  |      ||||  |        |  |||  |               | || |  | |||   |             |    |            |  || ||   |        |  |   |        | ||||  || |||  |                               | | |     ||||  ||||| |||||  |      |  ||  |        ||||      |  |        | | ||              |||   |        | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | ||||   | | ||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..        ^*****   |  |        |              | ||  |^*****    |||^***** ^*****|          |  ||  |   | ||| |      |       | | | |       | |                        | |          |  |            |  |       ||  | | |||                                    |   | |        ^*****                   || |||                 || |||  |          |  |               | |                 |   |    |  |^***** |  | | |||||   | || | || ^*****    ^*****         ||  | |        | ||  ^*****                           |  || ||^*****     | | |   ||  || ^*****  | |           | |||^*****   |     ||||       ||  ||   |  | | |        |   |         |  |                       ||||  | |  |  | |   | |  |||^*****    |  ||||||||  ||||||     || || ^*****|         | |       |  ||^*****  ||          |  ||        || ||   |  ||  |   |  |      |^*****        |  |||  |               | || |  | |^*****             ^*****            |  || ||   |        |  |   |        | ||^***** ^*****                               | | |     ||||  ||^*****|||  |      |  ||  |        ||||      |  |        | | ||              |^*****        | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | ||^***** | ||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..                 |  |        |              ^***  | |        |||        || |||          |  ||  |   | ||| |      |       | | | |       | |                        | |          |  |            |  |       ||  | | |||                                    |   | |                                 || |||                 || |||  |          |  |               | |                 |   |    |  ||| |   |  | | |||||   | || | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  ||  ||     | |           | |||||   |   |     ||||       ||  ||   ^*** | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||       |  ||||||||  ||||||     || ||  || |||         | |       |  ||||||||  ||          |  ||        || ||   |  ||  |   |  |      | ||  |        |  |||  |               | || |  | |||                                   |  || ||   |        |  |   |        | || |  |  |||  |                               | | |     ||||  || || | |||  |      ^***^***        ||||      |  |        | | ||              | |            | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  4FE4S_FER_1 ..                 |  |        |              | |   | |        |||        || |||          |  ||  |   | ||| |      |       | | | |       | |                        | |          |  |            |  |       ||  | | |||                                    |   | |                                 || |||                 || |||  |          |  |               | |                 |   |    |  ||| |   |  | | |||||   | || | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  ||  ||     | |           | |||||   |   |     ||||       ||  ||        | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||       |  ^**^**^***^*||||     || ||  || |||         | |       |  ^**^**^***^*          |  ||        || ||   |  ||  |   |  |      | ||  |        |  |||  |               | || |  | |||                                   |  || ||   |        |  |   |        | || |  |  |||  |                               | | |     ||||  || || | |||  |                      ||||      |  |        | | ||              | |            | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                 |  |        |              | |   | |        |||        || |||          *****  |   | ||| |      |       | | | |       | |                        | |          |  |            |  |       ||  | | |||                                    |   | |                                 || |||                 *****|  |          |  |               | |                 |   |    *****| |   |  | | |||||   | || | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  |*****     | |           | |||||   |   |     ||||       |*****        | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||     || ||  || |||         | |       |  ||||||||  |           *****        || ||   |  ||  |   |  |      | ||  |        *****|  |               | || |  | |||                                   |  || ||   |        |  |   |        | || |  *****|  |                               | | |     ||||  || || | |||  |                      ||||      |  |        | | ||              | |            | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                 |  |        |              | |   | |        |||        || |||          |  |   |   | ||| |      |       | | | |       | |                        | |          |  |            |  |       ||  | *****                                    |   | |                                 || |||                 || |||  |          |  |               | |                 |   |    |  | | |   |  | | |||||   | || | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  ||  |      | |           | |||||   |   |     ||||       ||  |         | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||     || ||  || |||         | |       |  ||||||||  |           |  |         || ||   |  ||  |   |  |      | ||  |        |  | |  |               | || |  | |||                                   |  || ||   |        |  |   |        | || |  |  | |  |                               | | |     ||||  || || | |||  |                      ||||      |  |        | | ||              | |            | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |  |||||        |   |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                 |  |        |              | |   | |        |||        || |||          |  |   |   | ||| |      |       | | ***       | |                        | |          |  |            |  |       ||  | ***|                                     |   | |                                 || |||                 || |||  |          |  |               | |                 |   |    |  | | |   |  | ***||||   ***| | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  ||  |      | |           | |||||   |   |     ||||       ||  |         | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||     || ||  || |||         | |       |  ||||||||  |           |  |         || ||   |  ||  |   |  |      | ||  |        |  | |  |               | || |  | |||                                   |  || ||   |        |  |   |        | || |  |  | |  |                               | | |     ***|  || || | |||  |                      ||||      |  |        | | ||              | |            | | ||||        |  | || |       ***|   |  |                                  |  | |        | |    ***| |     | ||  || || |  ***||        |   |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                 |  |        |              | |   | |        |||        || |||          |  |   |   | ||| |      |       | |           | |                        | |          |  |            |  |       ||  | |  |                                     |   | |                                 || |||                 || |||  |          |  |               | |                 |   |    |  | | |   |  |    ||||   |  | | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  ||  |      | |           | |||||   |   |     ||||       ||  |         | |        |   |         |  |                       ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||     || ||  || |||         | |       |  ||||||||  |           |  |         || ||   |  ||  |   |  |      | ||  |        |  | |  |               | || |  *****                                   |  || ||   |        |  |   |        | || |  |  | |  |                               | | |      | |  || || | |||  |                      ||||      |  |        | | ||              | |            | | ||||        |  | || |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        |   |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                 |  |        |              | |   | |        |||        |****|          ****   |   ****| |      |       | |           | |                        | |          |  |            |  |       ||  | ****                                     |   | |                                 *****|                 ****|****          |  |               | |                 |   |    **** | |   |  |    ||||   |  | | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  |****      | |           ****|||   |   |     ||||       |****         | |        |   |         ****                       ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||     *****  |****|         | |       |  ||||||||  |           ****         ****|   |  ||  |   |  |      | ||  |        **** |  |               | || |  ****|                                   ****| ||   |        ****   |        | || |  **** ****                               | | |      | |  || || | |||  |                      ||||      |  |        | | ||              | |            | ****||        **** || |       ||||   |  |                                  |  | |        | |    | || |     | ||  |**** |   ||||        |   |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                 |  |        |              | |   | |        |||        |  | |                 |   | | ***      |       | |           | |                        | |          |  |            |  |       ||  |                                          |   | |                                    | |                  |  ||  |          |  |               | |                 |   |         | |   |  |    ||||   |  | | ||  |         |||||         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  |          | |             |||||   |   |     ||||       |   |         | |        |   |                                    ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |  ***         | |       |  ||||||||  |                         |  |   |  ||  |   |  |      | ||  |             |  |               | || |    | |                                       | ||   |        |  |   |        | || |                                          | ***      | |  || || | |||  |                      ||||      |  |        | | ||              | |            |   ||||           | || |       ||||   |  |                                  |  | |        ***    | || |     | ||  || || |   ||||        |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..                 |  |        |              ***   ***        |||        |  ***                 |   | ***        |       | |           ***                        ***          |  |            |  |       ||  |                                          |   ***                                    ***                  |  ||  |          |  |               ***                 |   |         ***   |  |    ****   |  | | ||  |         *****         ||  | |        | ||  |                                |  || || ||  |     | | |   ||  |          ***             *****   |   |     ****       |   |         ***        |   |                                    ****  | |  |  ***   ***  ******       |  |******|  | ****         |  |              | |       |  |******|  |                         |  |   |  ||  |   |  |      | ||  |             |  |               | || |    ***                                       | ||   |        |  |   |        | || |                                          ***        ***  |***| | |||  |                      ****      |  |        | | ||              ***            |   ****           ***| |       ****   |  |                                  |  | |               | || |     | ||  || || |   ****        |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..                 ****        |                               |||        |    |                 |   |            |       ***                                      | |          ****            ****       |****                                          |   | |                                                         ********          ****                                   |   |               ****     ***   **** *******                       |******        *******                                **************     | ***   |****                                  |   |                |   |                    |   |                                       **** ****                ***       ****      ****              ****              ***       ****|     ****                         ****   ********   ****      *******             ****               ******                                              ***|   |        ****   |        ******                                          | |             |   | ********                                ****        | ****                             |   | |               ***              ****                                  ******               ******     *************               |   |  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                             |                               |||        ******                 |   |            |                                                | |                                     |   |                                          |   | |                                                                                                                  |   |                                                                 |   | |                                                                  | | |   |                                      |   |                |   |                    |   |                                                                                                                                      |                                                                                                                                                         | ||   |           |   |                                                        | |             |   | | |                                                 |   |                              |   | |                                                                         | |                                                      |   |  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                             |                               |||                               |   |            |                                                | |                                     |   |                                          |   | |                                                                                                                  *****                                                                 |   | |                                                                  | | *****                                      |   |                |   |                    |   |                                                                                                                                      |                                                                                                                                                         | |*****           |   |                                                        | |             |   | | |                                                 |   |                              |   | |                                                                         | |                                                      |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                             |                               |||                               *****            |                                                | |                                     *****                                          ***** |                                                                                                                                                                                        ***** |                                                                  | |                                            *****                *****                    *****                                                                                                                                      |                                                                                                                                                         | |                *****                                                        | |             |   | | |                                                 *****                              ***** |                                                                         | |                                                      *****  
search RasMol script viewer Motif-ligand binding stats  stturn ..                             |                               ***                                                |                                                ***                                                                                        ***                                                                                                                                                                                            ***                                                                  ***                                                                                                                                                                                                                                     |                                                                                                                                                         ***                                                                             ***             |   | ***                                                                                        ***                                                                         ***                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                             *                                *                                                 *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       *                                                                                                                                                                                                                                                         *   *                                                                                                                                                                                                                                        

chain B : PROTEIN (PYRUVATE-FERREDOXIN OXIDOREDUCTASE)
member of: CATH:search3.30.70.20/search3.40.50.920/search3.40.50.970/search3.40.920.10/search4.10.780.10/search4.10.790.10GENE3D:searchG3DSA_3.30.70.20/searchG3DSA_3.40.50.920/searchG3DSA_3.40.50.970/searchG3DSA_3.40.920.10/searchG3DSA_4.10.780.10/searchG3DSA_4.10.790.10PANTHER:searchPTHR32154/searchPTHR32154_SF0PFAM:searchPF00037/searchPF01558/searchPF01855/searchPF02775/searchPF10371PIRSF:searchPIRSF000159PROSITE PATTERNS:searchPS00198, PROSITE PROFILES:searchPS51379, SMART:searchSM00890SUPERFAMILY:searchSSF52518/searchSSF52922/searchSSF53323/searchSSF54862TIGRFAMS:searchTIGR02176UniProt:searchP94692
JMol viewer RasMol script viewer  TPP 1236B  ..                          ***                                 *                       *   *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    *                    ***                            **                                                                                           ****   *                     * *****                                                                                                                                                                                                                                           
JMol viewer RasMol script viewer  SF4 1235B  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              *                                                                                                                                                                                                                                                                                                                                                               **  * *                    ||*   *                        ||                                                                                           ||||   |                     | |||||                                                                         **                                                                                                                                                                
JMol viewer RasMol script viewer  SF4 1234B  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              *                **  **                                        ***** *                                                           ||  | |                    |||   |                        ||                                                                                           ||||   |                     | |||||                                                                         ||                                                                                                                                                                
JMol viewer RasMol script viewer  SF4 1233B  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | *    ***** *   ||  ||                                        ||||| |   ***   **                                                ||  | |                    |||   |                        ||                                                                                           ||||   |                     | |||||                                                                         ||                                                                                                                                                                
JMol viewer RasMol script viewer  CA 1238B  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | |    ||||| |   ||  ||                                        ||||| |   |||   ||                                                ||  | |                    |||   |                        ||                                                                                           ||||   |             * *     | |||||                                                           * * *         ||                                                                                                                                                                
JMol viewer RasMol script viewer  MG 1237B  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | |    ||||| |   ||  ||                                        ||||| |   |||   ||                                                ||  | |                    |||   |                        ||                                                                                           |*||   |             | |     * *||||                                                           | | |         ||                                                                                                                                                                
JMol viewer RasMol script viewer  SF4 1235A  ..                          |||                                 |                       |   |                                                                                                                                                                                                                                                                                                                                                                              |                                                                                                                                                                                                                              | |    ||||| |   ||  ||                                        ||||| |   |||   ||                                                ||  | |                    |||   |                        ||                                                                                           ||||   |             | |     | |||||                                                           | | |         ||                                                                                                                                  *                             
sec str:  ...eeeeeeehhhhhhhhhhhh..eeee......hhhhhhhhhhhh...........eeee...hhhhhhhhhhhhh.....eeee.hhhhhhhhhhhhhhhh.....eeeeee..............hhhhhhhhh..eeee...hhhhhhhhhhhhhhhhhh...eeeeee.......eeeeeee.hhhhhhh..hhhhhhhhhh...hhh............hhhhhh..hhhhhhhhhhhhhhhhhhhhhh......eeeee.....eeeee..hhhhhhhhhhhhhhhh...eeeeee.......hhhhhh.......eeeeee..........hhhhhhhhhhhhh......eeeee..hhh....hhhhhhhhhhhh.................................eeeeeeeee....hhhhhhhhhhhhhhh...eeeeeee........eeeeeeeee..............eeee..hhhhhh...........eeeee.....hhhhhhh..hhhhhhhhh...eeeee.hhhhhhh.......hhhhhhhhhhh.....hhhhhhhhhhhhhh........hhhhhhhhhhhhhhh.......hhhhh............hhhhh.hhhhh...hhh..hhh..........hhhh.......eeeee.hhh.....hhhhh.....eeeeeeehhhh...................eeeeeee.........hhhhh.......eeeeehhhhhhhhhhhhhhhhh............hhhhhh................hhhhhhhhhhhhhheeeee...hhhhhhh................eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhh......hhhhhhhhhhhh......hhhhhhhhhhhhh...eeeeeeehhhhh...hhhhhhhhh.....eeeeee..................................hhhhhhhh...eeeee.....hhhhhhhhhhhhh....eeeeee...hhh.....hhhhhhhhhhhhh......eee.hhhhhh....eee........hhhhhh..hhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhh....................................................hhhhhhhhhhh..
sequence :  ..GKKMMTTDGNTATAHVAYAMSEVAAIYPITPSSTMGEEADDWAAQGRKNIFGQTLTIREMQSEAGAAGAVHGALAAGALTTTFTASQGLLLMIPNMYKISGELLPGVFHVTARAIAAHALSIFGDHQDIYAARQTGFAMLASSSVQEAHDMALVAHLAAIESNVPFMHFFDGFRTSHEIQKIEVLDYADMASLVNQKALAEFRAKSMNPEHPHVRGTAQNPDIYFQGREAANPYYLKVPGIVAEYMQKVASLTGRSYKLFDYVGAPDAERVIVSMGSSCETIEEVINHLAAKGEKIGLIKVRLYRPFVSEAFFAALPASAKVITVLDRTKEPGAPGDPLYLDVCSAFVERGEAMPKILAGRYGLGSKEFSPAMVKSVYDNMSGAKKNHFTVGIEDDVTGTSLPVDNAFADTTPKGTIQCQFWGLGADGTVGANKQAIKIIGDNTDLFAQGYFSYDSKKSGGITISHLRFGEKPIQSTYLVNRADYVACHNPAYVGIYDILEGIKDGGTFVLNSPWSSLEDMDKHLPSGIKRTIANKKLKFYNIDAVKIATDVGLGGRINMIMQTAFFKLAGVLPFEKAVDLLKKSIHKAYGKKGEKIVKMNTDAVDQAVTSLQEFKYPDSWKDAPAETKAEPMTNEFFKNVVKPILTQQGDKLPVSAFEADGRFPLGTSQFEKRGVAINVPQWVPENCIQCNQCAFVCPHSAILPVLAKEEELVGAPANFTALEAKGKELKGYKFRIQINTLDCMGCGNCADICPPKEKALVMQPLDTQRDAQVPNLEYAARIPVKSEVLPRDSLKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYGFGMNMSMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFGGDGWAYDIGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFPGPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQVAHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTPMMARPDSGEACDQNRAGTSEQQGDLSKRTKK
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432       442       452       462       472       482       492       502       512       522       532       542       552       562       572       582       592       602       612       622       632       642       652       662       672       682       692       702       712       722       732       742       752       762       772       782       792       802       812       822       832       842       852       862       872       882       892       902       912       922       932       942       952       962       972       982       992       1002      1012      1022      1032      1042      1052      1062      1072      1082      1092      1102      1112      1122      1132      1142      1152      1162      1172      1182      1192      1202      1212      1222       
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..       ||  | |  ||  |        |   |  |       | ||  |||  ||||  || ||   | ||| |||          |  |   |  || |||      | |       | | | |       | |      |  |          |   | |       | ||  |            |  ||   |  ||  | | |                                      |  || || |     |    |       |  ||  |    || |||                  |  || |||  |  |   |  |               | |                       |  |^***| | | |  | | |||||   | || | | ||    |   |||||||         ||  | |        ||||  |    |   | |                     |  || |||||  |     | ||| | ||  |  |    |  | |           | |||||   |   |     ||||       |   |    |  | | |  ||    | ||||| |   | ||||    |  |               ||||  | || || | |   | |  ||||||  |    |  ||||||||  ||||||         | ||  ^*** | |   |  |       |  ||||||||  ||            | ||       || ||   |  ||  | | |  |      ||||  |             |  |   ^***        | || | ||||||   |  |  |       | ^***|   |       || || ||   |        |  |            | ||||   | |    |    | |                        | ||      ||||  |||||||| ||  |      |  || ||        ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       |||| | |  |        |  |                      |  | |        | |    | ||||   | ||||  || || |   ||||        || || |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..       ||  | |  ||  |        |   |  |       | ||  |||  ^**|  || ||   | ||| |||          |  |   |  || |||      ^**       | | | |       | |      |  |          |   | |       | ||  |            |  ||   |  ||  | | |                                      |  |^**^**     |    |       |  ||  |    || |||                  |  || ^**  |  |   |  |               | |                       |  |   || | | |  | | |||||   | || | ^**|    |   |||||||         ||  | |        |^**  |    |   | |                     |  || |||||  |     | ||| | ||  |  |    |  | |           | |||||   |   |     ||||       |   |    |  | | |  ||    | ||||| |   | ^**|    |  |               ||||  | || || | |   | |  ||||||  |    |  ||||||||  ||||||         | ||   ||  | |   |  |       |  ||||||||  ||            ^**|       || ||   |  ||  ^** |  |      ||||  |             |  |               | || | ^**|||   |  |  |       |    ||   |       || || ||   |        |  |            | ||||   | |    |    ^**                        | ||      ||||  |||||^** ||  |      |  |^**|        ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       |||| | |  |        |  |                      |  | |        | |    | ||||   | ||||  || || |   ||||        |^**^**
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..       ||  | |  ||  |        |   ^***       | ||  |||  ^***  || ||   | ||| |||          |  |   |  || |||        |       | | | |       | |      ^***          |   | |       | |^***            |  ||   |  ||  | | |                                      |  || |        |    |       ^***^***    || |||                  |  ||  |   ^***   |  |               | |                       ^***   || | | |  | | |||||   | || | |  |    |   |||||||         ||  | |        | ||  |    |   | |                     |  || |||||  |     | |^*** ||  |  |    |  | |           | |||||   |   |     ||||       |   |    |  | | |  ||    | |||^***   | ^***    ^***               ||||  | |^*** | |   | ^***|||||  |    |  ||||||||  ||||||         | ||   |^*** |   |  |       |  ||||||||  ||            ^***       || ||   |  ||  |   |  |      ||||  |             |  |               | || |  | |||   |  ^***       |    ||   |       || || ||   |        |  |            | ||||   | |    |                               ^***      ||||  ||||| || ||  |      |  ||  |        ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||^*** |  |        ^***                      |  | |        | |    | ||||   ^***||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..       ||  | |  ||  |        |              | ||  |||   |    || ||   | ||| |||          |  |   |  || |||        |       | | | |       | |                    |   | |       | ||  |            |  ||   |  ||  | | |                                      |  || |        |    |                   || |||                  |  ||  |          |  |               | |                              || | | |  | | |||||   | || | |  |    |   |||||||         ||  | |        | ||  |    |   | |                     |  || |||||  |     | | |   ||  |  |    |  | |           | |||||   |   |     ||||       |   |    |  | | |  ||    | |||||     |  |                         ||||  | |  |  | |   | |  ||||||  |    |  ||||||||  ||||||         | ||   |     *******^       |  ||||||||  ||                       || ||   |  ||  |   |  |      ||||  |             |  |               | || |  | |||   |             |    ||   |       || || ||   |        |  |            | ||||   | |    |                               | |       ||||  ||||| || ||  |      |  ||  |        ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | ||||   | | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..       |^*****  ||  |        |              | ||  |^*****    || ^***** ^*****|          |  |   |  || |||        |       | | | |       | |                    |   | |       | ||  |            |  ||   |  ||  | | |                                      |  || |        ^*****                   || |||                  |  ||  |          |  |               | |                              ^***** |  | | |||||   | || | |  ^*****   |^*****         ||  | |        | ||  ^*****   | |                     |  || ||^*****     | | |   ||  |  ^*****  | |           | |||^*****   |     ||||       |   |    |  | | |  ||    | |||||     |  |                         ||||  | |  |  | |   | |  |||^*****    |  ||||||||  ||||||         | ^*****         |  |       |  ||^*****  ||                       || ||   |  ||  |   |  |      |^*****             |  |               | || |  | |^*****             ^*****|   |       || || ||   |        |  |            | ||^***** ^*****                               | |       ||||  ||^***** ||  |      |  ||  |        ||||      |  |        | | ||            | |^*****  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | ||^***** | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..       |   |    ||  |        |              ^***  | |        ||  |      || |||          |  |   |  || |||        |       | | | |       | |                    |   | |       | ||  |            |  ||   |  ||  | | |                                      |  || |                                 || |||                  |  ||  |          |  |               | |                               | |   |  | | |||||   | || | |           | |||||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |           | |||||   |   |     ||||       |   |    ^*** | |  ||    | |||||     |  |                         ||||  | |  |  | |   | |  ||||||       |  ||||||||  ||||||         |  |             |  |       |  ||||||||  ||                       || ||   |  ||  |   |  |      | ||  |             |  |               | || |  | |||                       |   |       || || ||   |        |  |            | || |                                          | |       ||||  || || |  ||  |      ^***^***        ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  4FE4S_FER_1 ..       |   |    ||  |        |              | |   | |        ||  |      || |||          |  |   |  || |||        |       | | | |       | |                    |   | |       | ||  |            |  ||   |  ||  | | |                                      |  || |                                 || |||                  |  ||  |          |  |               | |                               | |   |  | | |||||   | || | |           | |||||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |           | |||||   |   |     ||||       |   |         | |  ||    | |||||     |  |                         ||||  | |  |  | |   | |  ||||||       |  ^**^**^***^*||||         |  |             |  |       |  ^**^**^***^*                       || ||   |  ||  |   |  |      | ||  |             |  |               | || |  | |||                       |   |       || || ||   |        |  |            | || |                                          | |       ||||  || || |  ||  |                      ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..       |   |    ||  |        |              | |   | |        ||  |      || |||          |  |   |  || |||        |       | | | |       | |                    |   | |       | ||  |            |  ||   |  ||  | | |                                      ***** |                                 || |||                  |  ||  |          |  |               | |                               | |   |  | | |||||   | || | |           | |||||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |           | |||||   |   |     ||||       |   |         | *****    | *****     |  |                         ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |             |  |       |  ||||||||  |                        || ||   |  ||  |   |  |      | ||  |             |  |               | || |  | |||                       |   |       ***** ||   |        |  |            | || |                                          | |       ||||  || || |  ||  |                      ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  asxmotif ..       *****    ||  |        |              | |   | |        ||  |      || |||          |  |   |  || |||        |       | | | |       | |                    |   | |       | ||  |            |  |*****  ||  | | |                                      |  || |                                 || |||                  |  ||  |          |  |               | |                               | |   |  | | |||||   | || | |           | |||||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |           | |||||   |   |     ||||       |   |         | |  |     | |||||     |  |                         ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |             |  |       |  ||||||||  |                        || ||   |  ||  |   |  |      | ||  |             |  |               | || |  | |||                       |   |       || || ||   |        |  |            | || |                                          | |       ||||  || || |  ||  |                      ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  asxturn ..                ||  |        |              | |   | |        ||  |      || |||          |  |   |  || |||        |       | | ***       | |                    |   | |       | ||  |            |  |       ||  | ***                                      |  || |                                 || |||                  |  ||  |          |  |               | |                               | |   |  | ***||||   ***| | |           | |||||         ||  | |        ***|  |        | |                     |  || || ||  |     | | |   ||  |          | |           | |||||   |   |     ||||       |   |         | |  |     | |||||     |  |                         ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |             |  |       |  ||||||||  |                        || ||   |  ||  |   |  |      | ||  |             |  |               | || |  | |||                       |   |       || || ||   |        |  |            | || |                                          | |       ***|  || || |  ||  |                      ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ***|   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                ||  |        |              | |   | |        ||  |      || |||          |  |   |  || |||        |       | |           | |                    |   | |       | ||  |            |  |       ||  |                                          |  || |                                 || |||                  |  ||  |          |  |               | |                               | |   |  |    ||||   |  | | |           | |||||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |           | |||||   |   |     ||||       |   |         | |  |     | |||||     |  |                         ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |             |  |       |  ||||||||  |                        || ||   |  ||  |   |  |      | ||  |             |  |               | || |  *****                       |   |       || || ||   |        |  |            | || |                                          | |        | |  || || |  ||  |                      ||||      |  |        | | ||            | |||   |  |       | ||||        || |||| |       ||||   |  |                                  |  | |        | |    | || |     | ||  || || |   ||||        ||  |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..                ||  |        |              | |   | |        ||  |      |****|          ****   |  |****|        |       | |           | |                    |   | |       | ||  |            |  |       ||  |                                          ****| |                                 *****|                  |  |****          ****               | |                               | |   |  |    ||||   |  | | |           ****|||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |           ****|||   |   |     ||||       |   |         | ****     | ****|     ****                         ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |             |  |       |  ||||||||  |                        ****|   |  ||  |   |  |      | ||  |             |  |               | || |  ****|                       |   |       ***** ||   |        ****            **** |                                          | |        | |  || || ****|  |                      ||||      |  |        | | ||            ****|   ****       ****||        *****|| |       ||||   |  |                                  |  | |        | |    | || |     | ||  |**** |   ||||        |****  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                ||  |        |              | |   | |        ||  |      |  | |                 |  || | |        |       | |           | |                    |   | |       ***|  |            |  |       ||  |                                              | |                                 |  | |                  |  ||  |          |  |               | |                               | |   |  |    ||||   |  | | |             |||||         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          | |             |||||   |   |     ||||       |   |         | |        |  || |                                  ||||  | |  |  | |   | |  ||||||       |  ||||||||  | ||||         |  |             |  |       |  ||||||||  |                         |  |   |  ||  |   |  |      | ||  |             |  |               | || |    | |                       |   |           | ||   |        |  |            | || |                                          | |        | |  || || |  ||  |                      ||||      |  |        | | ||              | |                ||||        |  | || |       ||||   |  |                                  |  | |        ***    | || |     | ||  || || |   ||||        |   |  
search RasMol script viewer Motif-ligand binding stats  nest ..                ||  |        |              ***   ***        ||  |      |  ***                 |  || ***        |       | |           ***                    |   ***          |  |            |  |       ||  |                                              ***                                 |  ***                  |  ||  |          |  |               ***                               ***   |  |    ****   |  | | |             *****         ||  | |        | ||  |        | |                     |  || || ||  |     | | |   ||  |          ***             *****   |   |     ****       |   |         ***        |  || |                                  ****  | |  |  ***   ***  ******       |  |******|  | ****         |  |             |  |       |  |******|  |                         |  |   |  ||  |   |  |      | ||  |             |  |               | || |    ***                       |   |           | ||   |        |  |            | || |                                          ***        ***  |***| |  ||  |                      ****      |  |        | | ||              ***                ****        |  ***| |       ****   |  |                                  |  | |               | || |     | ||  || || |   ****        |   |  
search RasMol script viewer Motif-ligand binding stats  niche ..                |****        |                               ||  |      |    |                 |  ||   |        |       ***                                  |   | |          ****            ****       |****                                              | |                                 |    |                  ********          ****                                                       ****     ***   **** ***                           |******        *******        ***                     **************     | ***   |****                                  |   |                |   |                    |  ****                                     **** ****                ***       ****      ****              ****             ****       ****|     ****                         ****   ********   ****      *******             ****               ******                              |   |           ***|   |        ****            ******                                          | |             |   | ********                                ****        | ****                                 | |         |    |***              ****                                  ******               ******     *************               |   |  
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                |   |        |                               ||  |      ******                 |  ******        |                                            |   | |                                     |   |                                              | |                                 ******                                                                                                                                                 |   | |                                                                  | | |   |                                      |   |                |   |                    |   |                                                                                                                                      |                                                              | |                                                                        |   |           | ||   |                                                                        | |             |   |                                                     |   |                                  | |         ******                                                          | |                                                      |   |  
search RasMol script viewer Motif-ligand binding stats  stmotif ..                |   |        |                               *****                             |   |            |                                            |   | |                                     |   |                                              | |                                                                                                                                                                                        |   | |                                                                  | | *****                                      |   |                |   |                    |   |                                                                                                                                      |                                                              | |                                                                        |   |           | |*****                                                                        | |             |   |                                                     |   |                                  | |                                                                         | |                                                      |   |  
search RasMol script viewer Motif-ligand binding stats  ststaple ..                *****        |                                |                                *****            |                                            ***** |                                     *****                                              | |                                                                                                                                                                                        ***** |                                                                  | |                                            *****                *****                    *****                                                                                                                                      |                                                              | |                                                                        *****           | |                                                                             | |             |   |                                                     *****                                  | |                                                                         | |                                                      *****  
search RasMol script viewer Motif-ligand binding stats  stturn ..                             |                                |                                                 |                                                ***                                                                                        ***                                                                                                                                                                                            ***                                                                  ***                                                                                                                                                                                                                                     |                                                              ***                                                                                        ***                                                                             ***             |   |                                                                                            ***                                                                         ***                                                             
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                             *                                *                                                 *                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                       *                                                                                                                                                                                                                                                         *   *                                                                                                                                                                                                                                        

   New search    1b0p:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML