triangle PDBeMotif: 1b0f  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.4.21.37
Classification hydrolase    | release date: Mon, Nov 9, 1998
Title crystal structure of human neutrophil elastase with mdl 101,
Authors C.TARDIF, H.A.SCHREUDER, J.T.PELTON, N.P.PEET, W.A.METZ
Method X-RAY DIFFRACTION (resolution: 3.00Å)
PDBe Citation   
Small molecules:    search NAG NAG binding statistics NAG   search SEI SEI binding statistics SEI   search FUC FUC binding statistics FUC
Modified residues:  search ASN ASN binding statistics ASN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
IVGGRRARPHAWPFMVSLQLAGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEDGY
DPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTL
VRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (ELASTASE)
member of: CATH:search2.40.10.10GENE3D:searchG3DSA_2.40.10.10PANTHER:searchPTHR24257/searchPTHR24257_SF16PFAM:searchPF00089PRINTS:searchCHYMOTRYPSINPROSITE PATTERNS:searchPS00134/searchPS00135, PROSITE PROFILES:searchPS50240, SMART:searchSM00020SUPERFAMILY:searchSSF50494UniProt:searchP08246
JMol viewer RasMol script viewer  SEI 300A  ..                        **              **                                                                                                              *               *****              ****                           
JMol viewer RasMol script viewer  NAG 413A  ..                        ||              ||                                                                                                              |               |||||              ||||                           
JMol viewer RasMol script viewer  NAG 411A  ..                        ||              ||                                                                                                     *        |               |||||              ||||                           
JMol viewer RasMol script viewer  FUC 412A  ..           *            ||              ||                                                                              *                      |        |               |||||    ****      ||||                           
JMol viewer RasMol script viewer  NAG 403A  ..           |            ||              ||         *                *                                                   |                      |        |               |||||    ||||      ||||                           
JMol viewer RasMol script viewer  NAG 401A  ..           |            ||              ||         |                | *                       *                         |                      |        |               |||||    ||||      ||||                           
JMol viewer RasMol script viewer  FUC 402A  ..           |            ||              ||       ***                | |                       |                         |                      |        |               |||||    ||||      ||||                           
sec str:  ................eeeeee..eeeeeeeeee..eeee.hhhh....hhheeeee............eeeeeeeeee............eeeee..........................eeeeee..............eeeeeeee.......eeeee...............eeee..eeeeeeee...........eeee.hhhhhhhhhhh..
sequence :  ..IVGGRRARPHAWPFMVSLQLAGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEDGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
seq num:  ..16        26        36        47        57        65        74        84        95        105       115       125       135       145       156       167       185       193       205       217       226       236     
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..  |  | | | |  |      |    |    |  | | | ||     |  |  |  | ^***||  |     ||     |   | | |      ^***  |  |    | || || |  |         | | |         ^***| |  |  |    |  |  | |||||||  |  |  ||| ||  |  |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..  |  | | | |  |      |    |    |  | | | ||     |  |  |  | | ^**|  |     ||     |   | | |            |  |    | || || |  |         | | |             | |  |  |    |  |  | |||||||  |  |  ||| ||  |  |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..  |  | | | |  |      |    |    |  | | | ||     |  |  |  | | ^***  |     ||     |   | | |            |  |    | || || |  |         | | |             | |  |  |    |  |  | |||||||  |  |  ||| ||  |  |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..  |  | | | |  |      |    |    |  | | | ||     |  |  |  | | || |  |     |******^   | | |            |  |    | || || |  |         | | |             | |  |  |    |  |  | |||||||  |  |  ||| ||  |  |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..  ^***** | |  |      ^*****    |  | | | ||     |  |  |  | | || |  |     ||         | | |            |  |    | || || |  |         | | |             | |  |  |    |  |  ^*****|||  |  ^***** ||  ^*****||      |  ||        
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..  ^***   | |  |                |  | | | ||     |  |  |  | | || |  |     ||         | | |            |  |    | |^*** |  |         | | |             | |  |  |    |  |  | |||||||  |     ||  ||     |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  LEUCINE_ZIPPER ..         | |  |                |  | | | ||     |  |  |  | | || |  |     ||         | | |            |  |    ********************** | |             | |  |  |    |  |  | |||||||  |     ||  ||     |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_HIS ..         | |  |                |  | ****^*     |  |  |  | | || |  |     ||         | | |            |  |      |  |  |  |           | |             | |  |  |    |  |  | |||||||  |     ||  ||     |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  TRYPSIN_SER ..         | |  |                |  |   | ||     |  |  |  | | || |  |     ||         | | |            |  |      |  |  |  |           | |             | |  |  |    |  |  ******^*****     ||  ||     |||||      |  ||        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         | |  |                |  |   | ||     |  |  |  | | || |  |     ||         | | |            |  |      |  |  |  |           | |             | |  |  |    |  |    |||||||        ||  ||     |||||      *****        
search RasMol script viewer Motif-ligand binding stats  asxturn ..         | |  |                |  |   | ||     |  |  |  | ***| |  |     ||         | | |            |  |      |  |  |  |           | |             | |  |  |    |  |    |||||||        ||  ||     |||||      |  |         
search RasMol script viewer Motif-ligand binding stats  betabulge ..         | |  |                |  |   | ||     |  |  |  | |  | |  |     **         | | |            |  |      |  |  |  |           | |             | |  |  |    |  |    |||||||        **  **     |||||      |  |         
search RasMol script viewer Motif-ligand binding stats  betaturn ..         | |  |                ****   ****     |  |  |  | |  | |  |                | | |            |  |      ****  |  |           | |             | |  |  |    ****    *******                   |||||      ****         
search RasMol script viewer Motif-ligand binding stats  nest ..         ***  |                |  |     |      |  |  |  | |  | |  |                *** |            |  |      |  |  |  |           | |             | |  |  |    |  |    ||***||                   *****                   
search RasMol script viewer Motif-ligand binding stats  niche ..           ****                ****     |      ****  **** **** ****                    |            ****      ****  ****           ***             ***  ****    ****    ||*****                    |***                   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                        |                                              |                                                                                ||||||                     ***                    
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                        *                                              *                                                                                ******                                            

   New search    1b0f:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors