triangle PDBeMotif: 1ayv  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.22.38
Classification hydrolase    | release date: Mon, Nov 10, 1997
Title crystal structure of cysteine protease human cathepsin k in with a covalent thiazolhydrazide inhibitor
Authors B.ZHAO, C.A.JANSON, S.S.ABDEL-MEGUID, W.W.SMITH
Method X-RAY DIFFRACTION (resolution: 2.30Å)
PDBe Citation   
Small molecules:    search IN6 IN6 binding statistics IN6
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CATHEPSIN K
member of: CATH:search3.90.70.10GENE3D:searchG3DSA_3.90.70.10PANTHER:searchPTHR12411/searchPTHR12411_SF55PFAM:searchPF00112PRINTS:searchPAPAINPROSITE PATTERNS:searchPS00139/searchPS00639/searchPS00640, SMART:searchSM00645SUPERFAMILY:searchSSF54001UniProt:searchP43235
JMol viewer RasMol script viewer  IN6 300A  ..                  *** ****                                  *  ****                                                                                             ***                    *                               
sec str:  ........hhhh..............hhhhhhhhhhhhhhhhhh.......hhhhhhh.....hhh...hhhhhhhhhh.......hhh............hhh.......eee.....hhhhhhhhhh...eeeee....hhhh..................eeeeeeeeee....eeeeee...........eeeee.....hhh.....eee..
sequence :  ..APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..     ||| ||||    |||    |    | |    | **^* |         |  || ||| |  |          | |  |   |  |||   |  ||| |          | || | |               | |  |  |      |  || | | |       |    | |    || || |       |        | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..     ||| ||||    |||    |    | |    |    ^**         |  || ||| |  |          | |  |   |  |||   |  ||^**          | || | |               | |  |  |      |  || | | |       |    | |    || || |       |        | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..     ||| ||||    |||    |    | |    |    | |         |  |^***| |  |          | |  |   |  |||   |  ||| |          | || | |               | |  |  |      |  || | | |       |    | |    |^*** |       |        | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..     ||| ||||    ||^*****    | ^*****    | |         |  |  ||^*****          | |  |   |  |^*****  ||| |          | ^*****               | |  |  |      |  || | | |       ^***** |    |  |  |       |        | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_CYS ..     ||| ||||    |******^*****           | |         |  |  ||  |             | |  |   |  | |      ||| |          |  | | |               | |  |  |      |  || | | |       |      |    |  |  |       |        | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_HIS ..     ||| ||||    |||    |                | |         |  |  ||  |             | |  |   |  | |      ||| |          |  | | |               | |  |  |      |  || | **^********      |    |  |  |       |        | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_ASN ..     ||| ||||    |||    |                | |         |  |  ||  |             | |  |   |  | |      ||| |          |  | | |               | |  |  |      |  || |   |              *****^**************        | |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..     ||| ||||    |||    |                | |         |  |  ||  |             | |  |   |  | |      ||| |          |  *****               | |  |  |      |  || |   |                   |  |  |                | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..     *** ||||    ***    |                | |         |  |  ||  |             | |  |   |  | |      *** |          |  ***                 | |  |  |      |  |***   |                   |  |  |                | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..      ****|||     |     |                | |         |  |  |****             | |  |   |  | |       |  |          |  |                   | |  ****      |  |      |                   |  |  |                | |        
search RasMol script viewer Motif-ligand binding stats  nest ..         ****     |     |                ***         |  |  |                 ***  |   |  ***       |  |          |  |                   | |  |  |      |  |      |                   |  |  |                ***        
search RasMol script viewer Motif-ligand binding stats  niche ..          ***     |     |                | |         *******                      |   |            ****          ****                   ***  ****      ****      |                   |  ****                           
search RasMol script viewer Motif-ligand binding stats  stmotif ..                  |     |                | |                                      *****                                                                          |                   |                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                  |     |                ***                                                                                                                     |                   |                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  *     *                                                                                                                                        *                   *                                 

   New search    1ayv:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML