triangle PDBeMotif: 1ax8  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification cytokine    | release date: Fri, Oct 31, 1997
Title human obesity protein, leptin
Authors D.K.CLAWSON, F.ZHANG, J.-P.WERY, J.M.BEALS, R.W.SCHEV, S.L.BRIGGS
Method X-RAY DIFFRACTION (resolution: 2.40Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDL
ENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OBESITY PROTEIN
member of: CATH:search1.20.1250.10GENE3D:searchG3DSA_1.20.1250.10PANTHER:searchPTHR11724PFAM:searchPF02024PIRSF:searchPIRSF001837PRINTS:searchLEPTINPRODOM:searchPD005698SUPERFAMILY:searchSSF47266UniProt:searchP41159
sec str:  ...hhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..IQKVQDDTKTLIKTIVTRINDI..LDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
seq num:  ..3         13          ..39        49        59        69        79        89        99        109       119       129       139     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   |              ..|| |     | | | ||        |  |                       || |||     |  |      |  ||| ||  ||  |    |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   |              ..** |     | | ^***        |  |                       || |||     ^***      |  ||| ||  ||  |    ^***   |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |              ..|  |     | |   |         |  |                       || |||               ^***** ||  ||  |           |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |              ..|  |     | |   |         ****                       |****|               |  ||  ||  ||  |           ****    
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |              ..|  |     | |   |                                    |  ***               |  ||  ||  ||  |                   
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |              ..****     ***   |                                    |    |               ********|  ||  |                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   |   |              ..           |   |                                    ******                       |  ||  |                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..   |   |              ..           *****                                                                 *****  |                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****              ..                                                                                    *****                   

Assembly 2     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : OBESITY PROTEIN
member of: CATH:search1.20.1250.10GENE3D:searchG3DSA_1.20.1250.10PANTHER:searchPTHR11724PFAM:searchPF02024PIRSF:searchPIRSF001837PRINTS:searchLEPTINPRODOM:searchPD005698SUPERFAMILY:searchSSF47266UniProt:searchP41159
sec str:  ...hhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh...
sequence :  ..IQKVQDDTKTLIKTIVTRINDI..LDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
seq num:  ..3         13          ..39        49        59        69        79        89        99        109       119       129       139     
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..   |   |              ..|| |     | | | ||        |  |                       || |||     |  |      |  ||| ||  ||  |    |  |   |  |    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..   |   |              ..** |     | | ^***        |  |                       || |||     ^***      |  ||| ||  ||  |    ^***   |  |    
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |   |              ..|  |     | |   |         |  |                       || |||               ^***** ||  ||  |           |  |    
search RasMol script viewer Motif-ligand binding stats  betaturn ..   |   |              ..|  |     | |   |         ****                       |****|               |  ||  ||  ||  |           ****    
search RasMol script viewer Motif-ligand binding stats  nest ..   |   |              ..|  |     | |   |                                    |  ***               |  ||  ||  ||  |                   
search RasMol script viewer Motif-ligand binding stats  niche ..   |   |              ..****     ***   |                                    |    |               ********|  ||  |                   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..   |   |              ..           |   |                                    ******                       |  ||  |                   
search RasMol script viewer Motif-ligand binding stats  stmotif ..   |   |              ..           *****                                                                 *****  |                   
search RasMol script viewer Motif-ligand binding stats  ststaple ..   *****              ..                                                                                    *****                   

   New search    1ax8:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors