triangle PDBeMotif: 1au0  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Enzyme   3.4.22.38
Classification hydrolase    | release date: Tue, Sep 9, 1997
Title crystal structure of the cysteine protease human cathepsin k in complex with a covalent symmetric diacylaminomethyl ketone inhibitor
Authors B.ZHAO, C.A.JANSON, S.S.ABDEL-MEGUID, W.W.SMITH
Method X-RAY DIFFRACTION (resolution: 2.60Å)
PDBe Citation   
Small molecules:    search SDK SDK binding statistics SDK
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRG
IDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNL
NHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : CATHEPSIN K
member of: CATH:search3.90.70.10GENE3D:searchG3DSA_3.90.70.10PANTHER:searchPTHR12411/searchPTHR12411_SF55PFAM:searchPF00112PRINTS:searchPAPAINPROSITE PATTERNS:searchPS00139/searchPS00639/searchPS00640, SMART:searchSM00645SUPERFAMILY:searchSSF54001UniProt:searchP43235
JMol viewer RasMol script viewer  SDK 300A  ..                 ***  ****                                      ***                                                                  *                         ***                     *                        *      
sec str:  ........hhhh..............hhhhhhhhhhhhhhhhhh.......hhhhhhh.....hhh...hhhhhhhhhh......................hhh.......eee.....hhhhhhhhhh...eeeee....hhhh..................eeeeeeeeee....eeeeee...........eeeee.....hhh.....eee..
sequence :  ..APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..         ||||     || | ||||| | |    ||**^* |           ||| |||    |          | |         |||   |   || |          | ||   |                    |  |      | ||| ||| |       |    | |    || || |       |     |  | |        
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..         ||||     || | ||||| | |    ||   ^**           ||| |||    |          | |         |||   |   |^**          | ||   |                    |  |      | ||| ||| |       |    | |    || || |       |     |  | |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..         ||||     || | ||||| | |    ||   | |           ||^***|    |          | |         |||   |   |  |          | ||   |                    |  |      | ||| ||| |       |    | |    |^*** |       |     |  | |        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..         ||||     |^*****||| | ^*****|   | |           ||| | ^*****          | |         |^*****   |  |          | ^*****                    |  |      | ||| ||| |       ^***** |    |  |  |       |     |  | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_CYS ..         ||||     ******^*****       |   | |           ||| |                 | |         | |       |  |          |  |                        |  |      | ||| ||| |       |      |    |  |  |       |     |  | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_HIS ..         ||||     || | ||||| |       |   | |           ||| |                 | |         | |       |  |          |  |                        |  |      | ||| ||**^********      |    |  |  |       |     |  | |        
search RasMol script viewer Motif-ligand binding stats  THIOL_PROTEASE_ASN ..         ||||     || | ||||| |       |   | |           ||| |                 | |         | |       |  |          |  |                        |  |      | ||| ||| |              *****^**************     |  | |        
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..         ||||     || | ***** |       |   | |           ||| |                 | |         | |       |  |          |  |                        |  |      | ||| ||| |                   |  |  |             |  | |        
search RasMol script viewer Motif-ligand binding stats  asxmotif ..         ||||     || | ||||  |       |   | |           ||| |                 | |         | |       |  |          |  |                        |  |      | ||***** |                   |  |  |             |  | |        
search RasMol script viewer Motif-ligand binding stats  asxturn ..         ||||     || | ||||  |       |   | |           ||| |                 | |         | |       |  |          |  |                        |  |      ***|***|  |                   |  |  |             |  | |        
search RasMol script viewer Motif-ligand binding stats  betaturn ..         ||||     || | ****  |       |   | |           |****                 | |         | |       |  |          ****                        |  |      |  |****  |                   |  |  |             **** |        
search RasMol script viewer Motif-ligand binding stats  gammaturn ..         ||||     || |  ||   |       |   | |           *** |                 | |         | |       |  |          |  |                        |  |      |  |      |                   |  |  |                | |        
search RasMol script viewer Motif-ligand binding stats  nest ..         ****     || |  ||   |       |   ***            |  |                 ***         ***       |  |          |  |                        |  |      |  |      |                   |  |  |                ***        
search RasMol script viewer Motif-ligand binding stats  niche ..                  |***  ||   |       |   | |            ****                                       ****          ****                        ****      ****      |                   |  ****                           
search RasMol script viewer Motif-ligand binding stats  ststaple ..                  |     |*****       ***** |                                                                                                                     |                   |                                 
search RasMol script viewer Motif-ligand binding stats  stturn ..                  |     |                ***                                                                                                                     |                   |                                 
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                  *     *                                                                                                                                        *                   *                                 

   New search    1au0:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML