triangle PDBeMotif: 1akz  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.2.
Classification glycosidase    | release date: Tue, May 27, 1997
Title human uracil-dna glycosylase
Authors C.D.MOL, J.A.TAINER
Method X-RAY DIFFRACTION (resolution: 1.57Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQ
RPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLV
FLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : URACIL-DNA GLYCOSYLASE
member of: CATH:search3.40.470.10GENE3D:searchG3DSA_3.40.470.10HAMAP:searchMF_00148PANTHER:searchPTHR11264/searchPTHR11264_SF0PFAM:searchPF03167PROSITE PATTERNS:searchPS00130, SMART:searchSM00986/searchSM00987SUPERFAMILY:searchSSF52141TIGRFAMS:searchTIGR00628UniProt:searchP13051
sec str:  .......hhhhhhhhhhhh.hhhhhhhhhhhhhhhh......hhh..hhh....hhh..eeeee........................hhhhhhhhhhhhh............hhhhhh.eeeee.................hhhhhhhhhhhhhhh....eeeee.hhhhhhhhh......eeeee.......hhh......hhhhhhhhhhhh..........
sequence :  ..MEFFGESWKKHLSGEFGKPYFIKLMGFVAEERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLENIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVSWLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELLQKSGKKPIDWKEL
seq num:  ..82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292          
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  | |   | || |             |  |         || || |||||||      | | | | | ||  || | |             || || |    | | | |  | |       | |  | |||||||||  |       |  |  |          **^* |||| |      | | ||| |||||||||       | ||||    | |
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  ^**   | || |             |  |         || || |||||||      | | | | | ||  || | |             || || |    | | | |  | |       ^**  | |^**|||||  |       |  |  |          | || |||| |      | | ||| |||||||||       | ^**|    | |
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |        | || |             |  |         || || |||||||      | | | | | ||  || | |             |^*** |    | | | |  | |         |  | |^***||||  |       |  |  |          | |^***|| |      | | ||| |||||||||       | ||||    | |
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..|  |        | || |             |  |         || || |||||||      | | | | | ^***** | |             |  |  |    | | | |  | |         |  | | |||||||  |       |  |  |          | || |||| |      | | ||| |||||||||       | ||||    | |
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..|  |        | || |             |  |         || || |||||||      | | | | |  |  |  | |             |  |  |    | | | |  | |         |  | | |||||||  |       |  |  |          | || |||| |      | | ||| |||||||||       | ^***    | |
search RasMol script viewer Motif-ligand binding stats  U_DNA_GLYCOSYLASE ..|  |        | || |             |  |         || || ||||||*******^** | | |  |  |  | |             |  |  |    | | | |  | |         |  | | |||||||  |       |  |  |          | || |||| |      | | ||| |||||||||       | |||     | |
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |        | || |             |  |         || || ||||||       | | | | |  |  |  | |             |  |  |    | | | |  | |         |  | | |||||||  |       |  |  |          | || |||| |      | ***** |||||||||       | |||     | |
search RasMol script viewer Motif-ligand binding stats  asxmotif ..|  |        | || |             |  |         || || |*****       | | | | |  |  |  | |             |  |  |    | | | |  | |         |  | | |||||||  |       |  |  |          | || |||| |      | | ||| |||||||||       | |||     | |
search RasMol script viewer Motif-ligand binding stats  asxturn ..|  |        | || |             |  |         || || |***||       | | | | |  |  |  | |             |  |  |    | *** |  | |         |  | | |||||||  |       |  |  |          | || |*** |      | | ||| |||||||||       | |||     | |
search RasMol script viewer Motif-ligand binding stats  betaturn ..|  |        **** |             |  |         ***** |****|       | | | | |  |  |  | |             |  |  |    | |   **** |         |  | | |||||||  |       |  |  |          **** | |  |      | *******||||||||       ****|     | |
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |          |  |             |  |            |  | |  |       | | | | |  |  |  | |             |  |  |    | |      | |         |  | | |||||||  |       |  |  |            |  | |  |      | | ||| |||||||||         | |     ***
search RasMol script viewer Motif-ligand binding stats  nest ..|  |          |  |             |  |            |  | |  |       | | | ***  |  |  | |             |  |  |    | |      ***         |  | ***|*****  |       |  |  |            |  | |  |      | | ||| *********         ***        
search RasMol script viewer Motif-ligand binding stats  niche ..****          ****             ****            **** ****       | ***      ****  ***             *******    ***                  **** ****   |   |       *******            **** ****      *** |||                              
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                               |                                                                            |   |                                         | *****                              
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                                               |                                                                            *****                                         ******                               
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                               |                                                                                                                          | ***                                
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                               *                                                                                                                          *                                    

   New search    1akz:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors