triangle PDBeMotif: 1aj7  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Classification immunoglobulin    | release date: Thu, May 15, 1997
Title immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody
Authors G.J.WEDEMAYER, L.H.WANG, P.A.PATTEN, P.G.SCHULTZ, R.C.STEVENS
Method X-RAY DIFFRACTION (resolution: 2.10Å)
PDBe Citation   
Small molecules:    search NPE NPE binding statistics NPE
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain L sequence:
DIQMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLES
EDFADYYCLQYASYPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Chain H sequence:
QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAY
LQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGAL
TSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain L : IMMUNOGLOBULIN 48G7 FAB (LIGHT CHAIN)
member of: CATH:search2.60.40.10GB:search4768677
JMol viewer RasMol script viewer  NPE 217H  ..                                                                                        * *  * * *                                                                                                                    
sec str:  .....eeee..eeeee....eeeeeee.......eeeeee.....eeeee.............eeeeee..eeeeee....hhh.eeeeeee...........eeeeee......eeeee...hhhhhh.eeeeeeeee.......eeeeee........eeeee...........eeeeeeeehhhhh...eeeeeee.......eeeeee....
sequence :  ..DIQMTQSPSSLSASLGERVSLTCRASQEISGYLSWLQQKPDGTIKRLIYAASTLDSGVPKRFSGSRSGSDYSLTISSLESEDFADYYCLQYASYPRTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151       161       171       181       191       201       211 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..             |  |    | |    | ||        | | |      |  |  ||**^*|  ||||     |  || ||                  |  |                 |||||||           | |      |  |   | |  |  |    | |         | ||||||  | |   |  |        | |  
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..             |  |    ^**    | ||        | ^**      |  |  ||  | |  ||||     |  || ||                  |  |                 |||||||           | |      |  |   | |  |  |    | |         | ||||||  | |   |  |        | |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..             ^***      |    | ||        | |        ^***  ||  | |  ^***     ^***| ||                  ^***                 |||||||           | |      |  |   | |  ^***    | |         ^***||||  | |   |  |        | |  
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..             |  |      ********^        | |           |  ||  | |   |||        || ||                                       |||||||           | |      |  |   | |          | |           ||||||  | |   |  |        | |  
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..             |  |           | ||        | |           |  ||  | ^*****|        || ||                                       |||||||           | |      |  |   | |          | |           ||||||  | |   |  |        | |  
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..             |  |           | ||        | |           |  ||  |     | |        || ||                                       |||||||           | |      |  |   | |          | |           ||||||  **^****  |        | |  
search RasMol script viewer Motif-ligand binding stats  betaturn ..             |  |           ****        | |           |  ||  |     | |        ****|                                       ******|           | |      ****   | |          | |           *****|        ****        | |  
search RasMol script viewer Motif-ligand binding stats  gammaturn ..             |  |           | |         | |           |  ||  |     | |         |  |                                           | |           | |             | |          | |             |  |        |  |        ***  
search RasMol script viewer Motif-ligand binding stats  nest ..             |  |           ***         ***           |  ||  |     | |         |  |                                           ***           | |             ***          ***             |  |        |  |             
search RasMol script viewer Motif-ligand binding stats  niche ..             ****                                     ********     ***         ****                                                         ***                                          ****        ****             

chain H : IMMUNOGLOBULIN 48G7 FAB (HEAVY CHAIN)
member of: CATH:search2.60.40.10GENE3D:searchG3DSA_2.60.40.10PANTHER:searchPTHR23266/searchPTHR23266_SF72PFAM:searchPF07654PROSITE PATTERNS:searchPS00290, PROSITE PROFILES:searchPS50835, SMART:searchSM00407SUPERFAMILY:searchSSF48726UniProt:searchP01857
JMol viewer RasMol script viewer  NPE 217H  ..                                * *           *                                                 * ***  *                                                                                                                 
sec str:  ....eeee...eee.....eeeeeeee...hhh..eeeeee.....eeeeeeee....eeee.hhh...eeeeee....eeeeee....hhh.eeeeee.hhh......eeeee........eeeee..........eeeeeeeeeee.....eeeehhh.....eee..........eeeeeeeeee.........eeeeeehhh.eeeeee......
sequence :  ..QVQLQQSGAELVKPGASVKLSCTASGFNIKDTYMHWVKQRPEQGLEWIGRIDPANGNTKYDPKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCASYYGIYWGQGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
seq num:  ..1         11        21        31        41        51        60        70        80        90        100       110       120       130       140       150       160       170       180       190       200       210    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      |  |      ^**        | |||       |  |        | || ||  |           || |||        || ||         | |  ||    || |^**         ^**  |||   |                | |||| ||         | |            || || | |   || |||  |        
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ^***                 | |||       |  |        | || |^***           || |||        ^***|         | |  ||    || |            | |  |||   |                | |||| ||         | |            || || | |   || ||^***        
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..                           | |||       |  |        | || |               || |||        || ||         ^*****^*****| |            | |  |^*****                | ^*****|         | |            || || | |   || |||           
search RasMol script viewer Motif-ligand binding stats  IG_MHC ..                           | |||       |  |        | || |               || |||        || ||         | |         | |            | |  | |                    | ||||  |         | |            || || **^****| |||           
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..                           | |||       |  |        | || |               || |||        || ||         | |         | |            | |  | |                    | ||||  |         | |            *****       || |||           
search RasMol script viewer Motif-ligand binding stats  asxmotif ..                           *****       |  |        | || |               *****|        || ||         | |         | |            | |  | |                    | ||||  |         | |            || ||       || |||           
search RasMol script viewer Motif-ligand binding stats  asxturn ..                           ***|        |  |        ******               || |||        || ||         | |         | |            | |  | |                    | ||||  |         | |            || ||       || |||           
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                           |  |        |  |        ******               ******        || ||         | |         | |            | |  | |                    | ||||  |         | |            || ||       ******           
search RasMol script viewer Motif-ligand binding stats  betaturn ..                           ****        ****           | |               |****|        ****|         | |         | |            | |  | |                    ****||  |         | |            ****|       |****|           
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                                       |  |           | |               |  | |         |  |         | |         | |            | |  ***                      | ||  |         | |             |  |       |  | |           
search RasMol script viewer Motif-ligand binding stats  nest ..                                       |  |           ***               |  ***         |  |         ***         | |            ***                           ***|  |         ***             |  |       |  ***           
search RasMol script viewer Motif-ligand binding stats  niche ..                                       ****                             |    |         ****         ***         ***                                             ****                         ****       |    |           
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                                                        ******                                                                                                                          ******           

   New search    1aj7:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors