triangle PDBeMotif: 1aay  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification transcription/dna    | release date: Sat, Jan 18, 1997
Title zif268 zinc finger-dna complex
Authors C.O.PABO, M.A.ROULD, M.ELROD-ERICKSON
Method X-RAY DIFFRACTION (resolution: 1.60Å)
PDBe Citation   
Small molecules:    search ZN ZN binding statistics ZN
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKR
HTKIHLRQKD
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : PROTEIN (ZIF268 ZINC FINGER PEPTIDE)
member of: CATH:search3.30.160.60GENE3D:searchG3DSA_3.30.160.60PANTHER:searchPTHR10042/searchPTHR10042_SF7PFAM:searchPF13465PROSITE PATTERNS:searchPS00028, PROSITE PROFILES:searchPS50157, SMART:searchSM00355SUPERFAMILY:searchSSF57667UniProt:searchP08046
JMol viewer RasMol script viewer  ZN 203A  ..                                                              *  *            *   *  
JMol viewer RasMol script viewer  ZN 202A  ..                                  *  *            *   *       |  |            |   |  
JMol viewer RasMol script viewer  ZN 201A  ..    *    *            *   *       |  |            |   |       |  |            |   |  
sec str:  ....ee........ee..hhhhhhhhhhhh....ee......ee..hhhhhhhhhhhh....ee......ee..hhhhhhhhhhh..
sequence :  ..RPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
seq num:  ..103       113       123       133       143       153       163       173       183  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..    | |  | | ||  |    ||  || || | |  | |^*** |    ||  || |    |  | ||       | ||  |  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..    | |  | **^*  |    ||  || || | |  | |  |  |    ||  || |    |  | ||       **^*  |  
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..    | |  |    ^***    ||  || || | |  | |  ^***    ||  || |    |  | ||         |   |  
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..    | |  |            ||  || || | |  | |          ||  || |    |  ^***         |   |  
search RasMol script viewer Motif-ligand binding stats  ZINC_FINGER_C2H2_1 ..    ^****^************^***^| || | ^**^************^***^| |    ^**^************^***^  
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..    | |  |             ***** || |    | |           ***** |       | |                 
search RasMol script viewer Motif-ligand binding stats  betaturn ..    | ****             ****| || |    | |           ****| |       | |                 
search RasMol script viewer Motif-ligand binding stats  nest ..    | |  |                 ***| |    ***               ***       ***                 
search RasMol script viewer Motif-ligand binding stats  niche ..    ******                 | |***                                                    
search RasMol script viewer Motif-ligand binding stats  stturn ..                           ***                                                       

chain B : DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3')
sec str:  .............
sequence :  ..AGCGTGGGCGT
seq num:  ..1          

chain C : DNA (5'-D(*TP*AP*CP*GP*CP*CP*CP*AP*CP*GP*C)-3')
sec str:  .............
sequence :  ..TACGCCCACGC
seq num:  ..51         

   New search    1aay:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML