triangle PDBeMotif: 1aap  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Classification proteinase inhibitor (trypsin)    | release date: Fri, Sep 14, 1990
Title x-ray crystal structure of the protease inhibitor domain of alzheimer's amyloid beta-protein precursor
Authors A.A.KOSSIAKOFF, C.EIGENBROT, L.A.KENNEDY, M.RANDAL, T.R.HYNES
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSA
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : ALZHEIMER'S DISEASE AMYLOID A4 PROTEIN
member of: CATH:search4.10.410.10GENE3D:searchG3DSA_4.10.410.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF00014PRINTS:searchBASICPTASEPROSITE PATTERNS:searchPS00280, PROSITE PROFILES:searchPS50279, SMART:searchSM00131SUPERFAMILY:searchSSF57362UniProt:searchP05067
sec str:  ...................eeeeeee....eeeeeee.........e.hhhhhhhhhh
sequence :  ..VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG
seq num:  ..1         11        21        31        41        51    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..| ||  |    | | |       |  |||   |  | |  |********^|     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..| ||  |    | | |       |  |||   |  ^***** |       |     
search RasMol script viewer Motif-ligand binding stats  BPTI_KUNITZ_1 ..| ||  |    | | |       |  |||   *****^************^     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..| ||  |    | | |       *****|      | |  | |             
search RasMol script viewer Motif-ligand binding stats  asxturn ..| ||  |    | | |          | |      | |  ***             
search RasMol script viewer Motif-ligand binding stats  gammaturn ..***|  |    | | |          | |      | |                  
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |    | | |          ***      ***                  
search RasMol script viewer Motif-ligand binding stats  niche ..   ****    *****                                        

chain B : ALZHEIMER'S DISEASE AMYLOID A4 PROTEIN
member of: CATH:search4.10.410.10GENE3D:searchG3DSA_4.10.410.10PANTHER:searchPTHR23103/searchPTHR23103_SF7PFAM:searchPF00014PRINTS:searchBASICPTASEPROSITE PATTERNS:searchPS00280, PROSITE PROFILES:searchPS50279, SMART:searchSM00131SUPERFAMILY:searchSSF57362UniProt:searchP05067
sec str:  ...................eeeeeee....eeeeeee.........e.hhhhhhhhhh
sequence :  ..VREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCG
seq num:  ..1         11        21        31        41        51    
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..   |  |    | | |       |  |||   |  | |  |********^|     
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..   |  |    | | |       |  |||   |  ^***** |   |   |     
search RasMol script viewer Motif-ligand binding stats  BPTI_KUNITZ_1 ..   |  |    | | |       |  |||   *****^************^     
search RasMol script viewer Motif-ligand binding stats  asxmotif ..   |  |    | | |       *****|      | |  | |   |   |     
search RasMol script viewer Motif-ligand binding stats  asxturn ..   |  |    | | |          | |      | |  ***   |   |     
search RasMol script viewer Motif-ligand binding stats  nest ..   |  |    | | |          ***      ***        |   |     
search RasMol script viewer Motif-ligand binding stats  niche ..   ****    *****                              |   |     
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                              *****     

   New search    1aap:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML