triangle PDBeMotif: 1a4i  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   1.5.1.5   3.5.4.9
Classification oxidoreductase    | release date: Fri, Jan 30, 1998
Title human tetrahydrofolate dehydrogenase / cyclohydrolase
Authors M.ALLAIRE, M.CYGLER, R.E.MACKENZIE, Y.LI
Method X-RAY DIFFRACTION (resolution: 1.50Å)
PDBe Citation   
Small molecules:    search NDP NDP binding statistics NDP
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MAPAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESE
VMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETG
VPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINY
VPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPG
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : METHYLENETETRAHYDROFOLATE DEHYDROGENASE /METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE;
member of: CATH:search3.40.50.10860/search3.40.50.720GENE3D:searchG3DSA_3.40.192.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01576PANTHER:searchPTHR10025/searchPTHR10025_SF30PFAM:searchPF00763/searchPF02882PRINTS:searchTHFDHDRGNASEPROSITE PATTERNS:searchPS00766/searchPS00767, SUPERFAMILY:searchSSF51735/searchSSF53223UniProt:searchP11586
JMol viewer RasMol script viewer  NDP 302A  ..                                                                                                                                                  *                      ****  *                  **                 ****  *              ***  ..NDP ..                         *                    
sec str:  .....eee.hhhhhhhhhhhhhhhhhhhhhh......eeeeeee...hhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhh.....eeee...........hhhhhhh..hhh......hhhhhhhhh.........hhhhhhhhhhhhh.......eeeee......hhhhhhhhhhh..eeeee......hhhhhhh..eeee.........hhh.....eeee........ .........hhhhhh...eee.....hhhhhhhhhhhhhhhhhhhh..
sequence :  ..APAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINY... ..KVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232      ... ..251       261       271       281       291   
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      | |                    |  || |                  |      |||   |   | ||||  |     || || |||       | | |       |  ||  |||||||   |    | ||  |    | |      | ||||||||                   | |^***   |  | | |  |  |      | | | | |  ||  |   | |   ..PS00001..|      |  || ||      |       |     |  || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      | |                    |  |^**                  |      |||   |   | ||||  |     || || |||       | | |       |  ||  |||||||   |    | ||  |    ^**      | ||||||||                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00005..|      |  || ||      |       |     |  |^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      | |                    |  |                     |      |||   |   | ^***  |     ^***| |||       | | |       |  ||  |||||||   |    | ||  |             | ||||||||                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00006..|      |  || ||      |       |     ^***       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      | |                    |  |                     |      |||   |   |  |||  |      |  | |||       | | |       |  ||  |||||||   |    | ||  |             | ||||||||                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00007..*******^  || ||      |       |                
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      | |                    |  |                     |      |^*****   |  |||  |      |  | |||       | | |       |  ||  |||||||   |    | ||  |             | |^*****|                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00008..|         || ||      |       |                
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      | |                    |  |                     |      | |       |  |||  |      |  | |||       | | |       |  ||  |||||||   |    | ||  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00009..*         || ||      |       |                
search RasMol script viewer Motif-ligand binding stats  RGD ..      | |                    |  |                     |      | |       |  |||  |      |  | |||       | | |       |  ||  |||||||   |    ***|  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00016..          || ||      |       |                
search RasMol script viewer Motif-ligand binding stats  THF_DHG_CYH_1 ..      | |                    |  |                     |      | |       |  ||************************** | |       |  ||  |||||||   |    | ||  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00766..          || ||      |       |                
search RasMol script viewer Motif-ligand binding stats  THF_DHG_CYH_2 ..      | |                    |  |                     |      | |       |  ||   |      |  | |||         | |       |  ||  |||||||   |    | ||  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..PS00767..          || ||      *********                
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      | |                    |  |                     |      | |       |  ||   |      |  | |||         | |       |  |*****|||||   |    | ||  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..alphabetamotif..          *****                               
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      | |                    |  |                     |      | |       |  ||   |      |  *****         | |       |  ||  |||||||   |    | ||  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |   ..asxmotif..          || ||                               
search RasMol script viewer Motif-ligand binding stats  asxturn ..      ***                    |  |                     |      | |       |  ||   |      |  ***|          | |       |  ||  |||||||   |    | ||  |             | |||||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   ***   ..asxturn..          || ||                               
search RasMol script viewer Motif-ligand binding stats  betaturn ..                             ****                     |      | |       |  ||   |      |  ****          | |       |  |********||   |    | ||  |             ****||****                   ****|     |  | | |  |  |      | | | | ********   | |   ..betaturn..          ****|                               
search RasMol script viewer Motif-ligand binding stats  gammaturn ..                             |  |                     |      | |       |  ||   |      |  |  |          | |       |  |   ***||||   |    | ||  |               | |||| |                     | |     |  | | |  |  |      | | | | |  ||  |   | |   ..gammaturn..           |  |                               
search RasMol script viewer Motif-ligand binding stats  nest ..                             |  |                     |      ***       |  ||   |      |  |  |          | |       |  |      ****   |    ***|  |               ***||| |                     ***     |  | ***  |  |      *** *** |  ||  |   | |   ..nest..           |  |                               
search RasMol script viewer Motif-ligand binding stats  niche ..                             ****                     |                ****|   |      *******          ***       ****       ***   |       ****               | |*****                             ****      ****      | | *** ********   ***   ..niche..           ****                               
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                      |                    *****                                              *****                          | |                                                      | |                      ..stmotif..                                              
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                      |                                                                                                      ***                                                      ***                      ..stturn..                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                      *                                                                                                                                                                                        ..REP00000..                                              

chain B : METHYLENETETRAHYDROFOLATE DEHYDROGENASE /METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE;
member of: CATH:search3.40.50.10860/search3.40.50.720GENE3D:searchG3DSA_3.40.192.10/searchG3DSA_3.40.50.720HAMAP:searchMF_01576PANTHER:searchPTHR10025/searchPTHR10025_SF30PFAM:searchPF00763/searchPF02882PRINTS:searchTHFDHDRGNASEPROSITE PATTERNS:searchPS00766/searchPS00767, SUPERFAMILY:searchSSF51735/searchSSF53223UniProt:searchP11586
JMol viewer RasMol script viewer  NDP 302B  ..                                                                                                                                                  *                      ****  *                  **    *            ****  *              ***                                        *                 
sec str:  .....eee.hhhhhhhhhhhhhhhhhhhhhh......eeeeeee...hhhhhhhhhhhhhhhhh..eeeeeee.....hhhhhhhhhhhhh.....eeee...........hhhhhhh..hhh......hhhhhhhhh.........hhhhhhhhhhhhh.......eeeee......hhhhhhhhhh...eeeee......hhhhhhh..eeee.........hhh.....eeee...eeee.......eeee....hhhhhh...eee......hhhhhhhhhhhhhhhhhhh..
sequence :  ..APAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKDVDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKKPNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLE
seq num:  ..2         12        22        32        42        52        62        72        82        92        102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292  
search RasMol script viewer Motif-ligand binding stats  ASN_GLYCOSYLATION ..      ||  ||                 |  || |                  |      |||   |   | || |        || || ||        | | |       |  ||  |||||||   |    | ||  |    | |        ||||||||                   | |^***   |  | | |  |  |      | | | | |  ||  |   | |     | || ||||      |  || ||      |       | |   |  || |    
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..      ||  ||                 |  |^**                  |      |||   |   | || |        || || ||        | | |       |  ||  |||||||   |    | ||  |    ^**        ||||||||                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || ||||      |  || ||      |       | |   |  |^**    
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..      ||  ||                 |  |                     |      |||   |   | ^***        ^***| ||        | | |       |  ||  |||||||   |    | ||  |               ||||||||                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || ||||      |  || ||      |       | |   ^***       
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE ..      ||  ||                 |  |                     |      |||   |   |  | |         |  | ||        | | |       |  ||  |||||||   |    | ||  |               ||||||||                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || |||*******^  || ||      |       | |   |          
search RasMol script viewer Motif-ligand binding stats  MYRISTYL ..      ||  ||                 |  |                     |      |^*****   |  | |         |  | ||        | | |       |  ||  |||||||   |    | ||  |               |^*****|                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || ||||         || ||      |       | |   |          
search RasMol script viewer Motif-ligand binding stats  AMIDATION ..      ||  ||                 |  |                     |      | |       |  | |         |  | ||        | | |       |  ||  |||||||   |    | ||  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || ^***         || ||      |       | |   |          
search RasMol script viewer Motif-ligand binding stats  RGD ..      ||  ||                 |  |                     |      | |       |  | |         |  | ||        | | |       |  ||  |||||||   |    ***|  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || |||          || ||      |       | |   |          
search RasMol script viewer Motif-ligand binding stats  THF_DHG_CYH_1 ..      ||  ||                 |  |                     |      | |       |  | ************************** | |       |  ||  |||||||   |    | ||  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || |||          || ||      |       | |   |          
search RasMol script viewer Motif-ligand binding stats  THF_DHG_CYH_2 ..      ||  ||                 |  |                     |      | |       |  |           |  | ||          | |       |  ||  |||||||   |    | ||  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || |||          || ||      ********* |   |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..      ||  ||                 |  |                     |      | |       |  |           |  | ||          | |       |  |*****|||||   |    | ||  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || |||          *****                |   |          
search RasMol script viewer Motif-ligand binding stats  asxmotif ..      *****|                 |  |                     |      | |       |  |           |  | ||          | |       |  ||  |||||||   |    | ||  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   | |     | || |||          || ||                |   |          
search RasMol script viewer Motif-ligand binding stats  asxturn ..       |   |                 |  |                     |      | |       |  |           |  ***|          | |       |  ||  |||||||   |    | ||  |               | |||| |                   | |||     |  | | |  |  |      | | | | |  ||  |   ***     ***| |||          || ||                |   |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..       |   |                 ****                     |      | |       |  |           |  |  |          | |       |  |********||   |    | ||  |               | ||****                   ****|     |  | | |  |  |      | | | | |  |****   | |     |  ****|          ****|                |   |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..       |   |                 |  |                     |      | |       |  |           |  |  |          | |       |  |   ***||||   |    | ||  |               | |||| |                     | |     |  | | |  |  |      | | | | |  ||  |   | |     |  | | |           |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  nest ..       |   |                 |  |                     |      ***       |  |           |  |  |          | |       |  |      ****   |    ***|  |               ***||| |                     ***     |  | ***  |  |      *** *** |  ||  |   | |     |  | ***           |  |                |   |          
search RasMol script viewer Motif-ligand binding stats  niche ..       |   |                 ****                     |                ****           *******          ***       ****       ***   |       ****               | |*****                             ****      ****      | | *** ********   ***     ****               ****                |   |          
search RasMol script viewer Motif-ligand binding stats  stmotif ..       |   |                                          |                                                                       *****                          | |                                                      | |                                                               |   |          
search RasMol script viewer Motif-ligand binding stats  ststaple ..       *****                                          |                                                                                                      | |                                                      | |                                                               *****          
search RasMol script viewer Motif-ligand binding stats  stturn ..                                                      |                                                                                                      ***                                                      ***                                                                              
search RasMol script viewer Motif-ligand binding stats  Catalytic site ..                                                      *                                                                                                                                                                                                                                                

   New search    1a4i:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors