triangle PDBeMotif: 1a07  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   2.7.1.112
Classification complex (transferase/peptide)    | release date: Tue, Dec 9, 1997
Title c-src (sh2 domain) complexed with ace-malonyl tyr-glu-(n,n- dipentyl amine)
Authors L.SHEWCHUK, S.JORDAN
Method X-RAY DIFFRACTION (resolution: 2.20Å)
PDBe Citation   
Small molecules:    search ACE ACE binding statistics ACE
Modified residues:  search PTR PTR binding statistics PTR
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chains A,B sequence:
MDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQ
FNSLQQLVAYYSKHADGLCHRLTTVCP
Chains C,D sequence:
YEX
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : C-SRC TYROSINE KINASE
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PRINTS:searchSH2DOMAIN/searchSH3DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP12931
JMol viewer RasMol script viewer  ACE 100C  ..             *                                                                                           
sec str:  ...hhh.........hhhhhhhh.........eeeee.......eeeeeeeee...eeeeeeeee.......eeee..eee..hhhhhhhhhh..............
sequence :  ..SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
seq num:  ..145       155       165       175       185       195       205       215       225       235       245  
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..||| |  ||| ||**^*||   |  ||  |     | ||| |   |  |                |  |    | ||     |  |||||||| ||         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..||| |  ||| |^**|^**   |  ||  |     | ^** |   |  |                |  |    ^**|     |  |||||||| ||         
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..||| |  ||| |^***||    |  ||  |     |  |  |   ^***                |  |    |  |     |  |||||||| ||         
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..||| |  ||| ||*****    |  ||  |     |  |  |                       |  |    |  |     **********| ||         
search RasMol script viewer Motif-ligand binding stats  betaturn ..|****  |*********     ****|  |     |  |  |                       ****    |  |     *********|****         
search RasMol script viewer Motif-ligand binding stats  nest ..||| |  | | |          |  ||  |     |  |  |                               |  |           |  |***          
search RasMol script viewer Motif-ligand binding stats  niche ..|******* ***          ********     *******                               ****           ****             
search RasMol script viewer Motif-ligand binding stats  stturn ..***                                                                                                      

chain C : ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)
JMol viewer RasMol script viewer  ACE 100C  ..*  
sec str:  .....
sequence :  ..YEX
seq num:  ..101

chain B : C-SRC TYROSINE KINASE
member of: CATH:search3.30.505.10GENE3D:searchG3DSA_2.30.30.40/searchG3DSA_3.30.505.10PANTHER:searchPTHR24418/searchPTHR24418_SF53PFAM:searchPF00017PRINTS:searchSH2DOMAIN/searchSH3DOMAINPROSITE PROFILES:searchPS50001/searchPS50002, SMART:searchSM00252/searchSM00326SUPERFAMILY:searchSSF50044/searchSSF55550UniProt:searchP12931
JMol viewer RasMol script viewer  ACE 100D  ..            *                                                                                           
JMol viewer RasMol script viewer  ACE 100C  ..         *  |                                                                                           
sec str:  ..............hhhhhhhh.........eeeee.......eeeeeeeee...eeeeeeeee.......eeee..eee..hhhhhhhhhh..............
sequence :  ..IQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
seq num:  ..146       156       166       176       186       196       206       216       226       236       246 
search RasMol script viewer Motif-ligand binding stats  CAMP_PHOSPHO_SITE ..|  |  |    |**^*|| | |  ||  |     | ||| |   |  |                | |||   | ||   |  ||||||  || |          
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE ..|  |  |    ^**|^** | |  ||  |     | ^** |   |  |                | |||   ^**|   |  ||||||  || |          
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE ..|  |  |    ^***||  | |  ||  |     |  |  |   ^***                | |||   |  |   |  ||||||  || |          
search RasMol script viewer Motif-ligand binding stats  alphabetamotif ..|  |  |     *****  | |  ||  |     |  |  |                       | |||   |  |   |  *****|  || |          
search RasMol script viewer Motif-ligand binding stats  betaturn ..****  |     ****   | |  |****     |  |  |                       ****|   |  |   |  ******  || |          
search RasMol script viewer Motif-ligand binding stats  gammaturn ..|  |  |            ***  ||  |     |  |  |                         | |   |  |   |   |   |  || |          
search RasMol script viewer Motif-ligand binding stats  nest ..|  |  |              |  ||  |     |  |  |                         ***   |  |   |   |   |  |***          
search RasMol script viewer Motif-ligand binding stats  niche ..*******              ********     *******                               ****   |   |   ****             
search RasMol script viewer Motif-ligand binding stats  stmotif ..                                                                               *****                    

chain D : ACE-MALONYL TYR-GLU-(N,N-DIPENTYL AMINE)
JMol viewer RasMol script viewer  ACE 100D  ..*  
sec str:  .....
sequence :  ..YEX
seq num:  ..101

   New search    1a07:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors