triangle PDBeMotif: 181l  
  coner Sequences coner   coner 3D motifs coner   coner Ligand environment coner   coner Ligand bonds coner
   
coner
   Search  |  PDB header search  |  Upload PDB file  |  Molecule binding  |  Pair bonds  |  Motif binding  |  3D environment  |  Motif inclusion  
coner
AstexViewer TM
Download original PDB file
Download xml file
Download structure factors file
Enzyme   3.2.1.17
Classification hydrolase (o-glycosyl)    | release date: Wed, Apr 19, 1995
Title specificity of ligand binding in a buried non-polar cavity o lysozyme: linkage of dynamics and structural plasticity
Authors A.MORTON, B.W.MATTHEWS
Method X-RAY DIFFRACTION (resolution: 1.80Å)
PDBe Citation   
Small molecules:    search HED HED binding statistics HED   search BNZ BNZ binding statistics BNZ   search CL CL binding statistics CL
Ligand bond colours:   *  covalent   *  ionic   *  hydrogen   *  electrostatic   *  van-der-waals   *  plane-atom   *  plane-plane   *  undefined  - Click here to show 5Å bonds
Chain A sequence:
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YKNL
Residue colours:  hydrophilic   hydrophobic   intermediate 
Assembly 1     View the assembly/model: ( JMolViewer Download PDB file RasMol script viewer AstexViewer™@MSD-EBI )
Motif search   chain:    Sequence numbers: 
   Using:   φ/ψ    residues code    secondary structures   
 coordinates of:  Cαs Side-chain
 
      View the fragment: rasmol script JMol viewer
chain A : T4 LYSOZYME
member of: CATH:search1.10.530.40GENE3D:searchG3DSA_1.10.530.40PFAM:searchPF00959PRINTS:searchT4LYSOZYMESUPERFAMILY:searchSSF53955UniProt:searchP00720
JMol viewer RasMol script viewer  BNZ 400A  ..                                                                                   *  *           *           *      *                                            
JMol viewer RasMol script viewer  HED 170A  ..                                                                                   |  |     *     |*          |      |                                            
JMol viewer RasMol script viewer  CL 178A  ..                              *                 *                                  |  |     |     ||          |      |                                            
JMol viewer RasMol script viewer  CL 173A  ..                              |                 |                                  |  |     |     ||          |      |                       * **                 
sec str:  ....hhhhhhhhh.............eee...eeee....hhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh..hhhhhhhhhhhhhh.hhhhhh.hhhhhhhhh..hhhhhhhhh..hhhhh.hhhhhhhhhhhhh.......
sequence :  ..MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAAAINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
seq num:  ..1         11        21        31        41        51        61        71        81        91        101       111       121       131       141       151         
search RasMol script viewer Motif-ligand binding stats  PKC_PHOSPHO_SITE .. | |           |   | |||         | | | |   |  |  | | | |  |  |              ||  |||    |  || |  ||            |  |  ^**|| |||                      |   ^**||| | ||
search RasMol script viewer Motif-ligand binding stats  CK2_PHOSPHO_SITE .. | |           |   | |||         | | | |   ^***  | | | |  ^***              ||  |||    |  || |  ||            |  |     || |||                      |   |  ||| | ||
search RasMol script viewer Motif-ligand binding stats  TYR_PHOSPHO_SITE .. | |           ********^         | | | |         | | | |                    ||  |||    |  || |  ||            |  |     || |||                      |   |  ||| | ||
search RasMol script viewer Motif-ligand binding stats  MYRISTYL .. | |               | |||         | | | |         | | | |                    ^*****|    |  || |  ||            |  |     || |||                      |   |  |^*****|
search RasMol script viewer Motif-ligand binding stats  alphabetamotif .. | |               | |||         | | | |         | | | |                     |  | |    |  || *****            |  |     || |||                      |   |  | | |  |
search RasMol script viewer Motif-ligand binding stats  asxmotif .. | |               *****         | | | |         | | | |                     |  | |    |  || |  |             |  |     || |||                      |   |  | | |  |
search RasMol script viewer Motif-ligand binding stats  asxturn .. ***               ***||         | | | |         | | | |                     |  ***    |  |***  |             |  |     || |||                      |   |  | | |  |
search RasMol script viewer Motif-ligand binding stats  betabulgeloop ..                   *****         | | | |         | | | |                     |  |      |  |  |  |             |  |     || |||                      |   |  | | |  |
search RasMol script viewer Motif-ligand binding stats  betaturn ..                   ****|         | | | |         | | | |                     |  |      |  |  ****             ****     |****|                      |   |  | | ****
search RasMol script viewer Motif-ligand binding stats  nest ..                     ***         | | | |         *** ***                     |  |      |  |                            |  ***                      |   |  *** |   
search RasMol script viewer Motif-ligand binding stats  niche ..                                 ***** |                                     ****      ****                            |    |                      |   |    | |   
search RasMol script viewer Motif-ligand binding stats  schellmannloop ..                                 | | | |                                                                               ******                      |   |    | |   
search RasMol script viewer Motif-ligand binding stats  ststaple ..                                 | | | |                                                                                                           *****    | |   
search RasMol script viewer Motif-ligand binding stats  stturn ..                                 *** ***                                                                                                                    ***   

   New search    181l:  Sequences  |  3D motifs  |  Ligand environment  |   Ligand bonds   |  SPICE view  |  PDB  |  XML  |  Structure factors