Peptidase sequences for Nocardia farcinica

>MER0041290 - At1g25290 ({Arabidopsis thaliana}) [S54.A08] peptidase unit: 68-286 ( active site residue(s): 185,231  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MNDRPPTCVRHRDRATGLACTRCGRPACPECLRPAAVGQHCVDCVREGSAGVRPVRTVAG       60
61       APVARSATPLVTYGLIAVNLVFFAITAVQARSIVDNFQSPLFFRLALIPAYVADGEWLRV      120
121      IGSGFLHWGPLHLALNMFALYIIGIQLEPVLGRWRLLAVYLVALLGGSAGGMLLEPANTI      180
181      GAGASGAVYGMFGAIAVVIFRLRLNPTQILVVIGINVFLSLSLPGISLWVHLGGLLAGTL      240
241      ATLGVLFLPEWLGVRTSETARTVGWAAIAAVGVASVAAIAVAAAML                    286

>MER0122904 - subfamily C82A unassigned peptidases [C82.UPA] peptidase unit: 142-251 ( active site residue(s): 210,228  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MAAMRSVRRHLFLAIVVIALAVFGSGAAAATLVGTTTTGTIAAITPSDGRMVGIAHPVTV       60
61       EFTQPVTDRARVERAVRVEAAAPLPGTVAWTGDRTLTWTPSAPLPADSTITVRAGDVRTE      120
121      FRTNAGVYAEADLSAHTFTVSIGGQVVRTMPASMGKPGFETPTGTFPVLEKFRSIVFDSR      180
181      TIGIPLSSPEGYLIDGEYAVRLTWGGVFVHSAPWSVDSQGYANVSHGCINLSPDDAAWYY      240
241      NTVGIGDPVYIHW                                                     253

>MER0055213 - family S15 unassigned peptidases [S15.UPW] peptidase unit: 163-413 ( active site residue(s): 215,352,381  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MRRAFRVTVAGLAAALFLPFLGSGATAAPLPTGPDGGAAGQAWAATHDGPQQFPNIHITW       60
61       DVPITMSDGTVLKANLYRPADVLGNPVPVATPTVVNMTPYTKLVSNLADHAGSVPGLSDA      120
121      MIGLFREIDMTGTPFSGVTDLTKAFGGGQLRNFAVDRSLVRSGYTQLVVDVRGTGFSQGE      180
181      WDMLRDREQQDTVEVIDWAARQPWSNGRIGMSGISYSAINQVQAAEKAPPALQAIFPIVP      240
241      GSDLVTDVLAPGGGFGFNFIPLWLTAINTLKWVPDVQSLVTGNFDQQWLTDRMDSPLTYM      300
301      DVFLNAYSKTRLEDLDPRVRSMLTDGSPERKAWLGDPSRITIPTFVVGGWHDLFTYSESQ      360
361      IYNQISAPPGHKQLLMGNTYHLNSGNEYAEPGLPPRLDVLQRAWFDRWLKDIDNGIDRYG      420
421      PVTLRQQGGGWITQNGFGDSAEGAEVAEHRRMYLSGAPSGTARSVYDGSLLAEQDGSTQR      480
481      LTVAPGLTGLCSNDAGQATAGVLAAIDACGADSRIQETNGLTFTSAPVAEPTVISGPIAV      540
541      RLNTVQDAADGYWSVTVNDVAPDGRSTVLSSGQLMASLRSIDESRSSRSANGDYTDPRPL      600
601      ASLEDRLPVIPGEPTTLDIALPATEAVLQPGHRLRVDVYAGNFPKGLPILPMLVDTGLKP      660
661      QHLQLDPQRPSFVNIPVRGNPGW                                           683

>MER0038260 - family M19 non-peptidase homologues [M19.UNW] peptidase unit: 5-249 ( metal ligand(s): 9,11,85,152,173 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MSPFLWEQHCCLPLTPDAEVAELARYPLGSYLSVNVGYSRQRTTDTLELLHAFRAAAVAD       60
61       GRFRLVDTLADVGAPGAIALAFDLEDAGPLGGDLDTVRVFHELGVRSLLPTYNHANAAGC      120
121      GCLDTEDTGLTAYGRDLVRVLNEVGVFVDGAHCSRRTGLDLAEHTDVPMIYSHANFAALW      180
181      EHPRNITDDQARACAATGGVIGINGVGIFLGRNRPEQAAERVEAMADHIQYGAELVGIEH      240
241      IGIGSDYSFDAADFNAELTENPGAFSDAYTAWGPLQWTAPEELLGLDSVPGLDQVLAARG      300
301      FTPADLAAVFGGNFCRAASKVWREH                                         325

>MER0189827 - intein-containing replicative DNA helicase precursor [N10.002] peptidase unit: 401-826,513-663 ( active site residue(s): 401,825,826  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MTTTDDRGHTDFPPEPPGEDFGRQPPHDMAAEQSVLGGMLLSKDAIADVVEVIRPGDFYR       60
61       PAHQAIYDTILDLYGRGEPADPVTVAAGLDRRGELKRIGGAPYLVTLTQTVPTAANAGYY      120
121      AEIVAEKAILRRLVEAGTRIVQYGYAGADGQDIAEVVDRAQAEVYEVTERRTTEDFLPLE      180
181      ELLQPTMDEIDSIASRGGISLGVPTGFSELDELTNGLHPGQMIIVAARPGVGKSTLGMDF      240
241      MRSCSIKHGLASVIFSLEMSRTEIVMRLLSAEAKIKLADMRSGRMSDDDWTKLARRMSEI      300
301      SEAPLFVDDSPNLTMMEIRAKARRLKQRHDLKLVVVDYLQLMTSGKKVESRQQEVSDFSR      360
361      NLKLLAKELEVPVVAISQLNRGPEQRTDKRPMVSDLRESGCLPASTRILRADTGAESTLG      420
421      ELLASGEQPLVWSLDERMRMVARPMVKVFPSGRKEVFRLRLASGREVEATGNHPFLTVDG      480
481      WIPLDRLTVGDRLATPRSVPEPVHTERMADAEVVLLAHMIGDGSCVRRQPVRYASIDEQN      540
541      LAAVSEAAEHFGVTAVRDDYAAARVTTLRLPAPYRLSRGKRNPIAAWLDELGLFGLRSHE      600
601      KFIPRRVFALPNDQVALFLRHLWATDGSVRWDSTYRQARVYYTSTSRRLIDDVAQLLLRL      660
661      GVHGRIRRVTKPGYRDAWHLTIDGADNQTVFLRDVGVHGARGDAAQVALAELEPLVRNTN      720
721      VDTVPNEVWNQVRHLLATKNITHREFSAAMGSRFCGSTMWKRSPSRSRLARVAAVLDDAD      780
781      IEMYATNDVFWDKIVEITSLGEQDVYDGTVPGTHNFVAQSISVHNSLEQDADMVILLHRP      840
841      DAFERDDPRGGEADLIVGKHRNGPTATITVAHQLHLSRFVDMARG                     885

>MER0055215 - signal peptidase II [A08.001] peptidase unit: 75-151 ( active site residue(s): 118,141  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006619) 
1        MTATASSAPTVSRWGRRLRWAITAAVLAGLDLALKAWAQTALDGAPVEAGPVDLRLAFNP       60
61       GAAFSIAADAPSWVMLSITTVITTGVAVGGWVLAPRASLLTRVALAAILGGAAANVIDRA      120
121      PDGLVTDYLHTGWWPTFNLADSFIVLGAIALIITTLIGNSDEREQLSPDHHTDKRD          176

>MER0888465 - subfamily M48B unassigned peptidases [M48.UPB] peptidase unit: 146-276 ( active site residue(s): 182 metal ligand(s): 181,185,222 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006619) 
1        MIVALGAAWAAALLSLASPAILQRITPSMTPRTAVACWLISLGSAVVLAGVAVTAALWPG       60
61       HAPGVGVAEAAMLCLTRVVHSVPHWLADPLTVAALAGVVGLSYRVALSARRHTRAGARVR      120
121      AYHRDVVSVVARRGDEDMPVMWLDHPKPMAYSVDGRPGMVVATEGLARKLNDGQRQAVLA      180
181      HELAHLRGGHHRLIRGCEVLAAAMPWIPLFADAPKAVAALAEFAADDCAAAATSPATIRS      240
241      ALCAVAATTGTEPASTLSLAGQVLQQRLQRLESSNPPRRSSRWVLMGLSPIVAAVAAPAG      300
301      LLTCAVVACVVMS                                                     313

>MER1021701 - family S15 unassigned peptidases [S15.UPW] peptidase unit: 58-272 ( active site residue(s): 143,271  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MNSATRVSRRRRVAAVLAAVAVAATACATAEAPASNEPVRQWGYLTLPTGERMRYSVVLP       60
61       EASGQFPVLVEYDGYGAGTEPSIGMPWVREGYAVVGLNVPGTGCSTGDNHMFGAEIGAAG      120
121      AFAVEWAAQQPWSTGRVGMIGYSYSGYNQLWTAAERPRGLTAITPSKNVGDPYRDVAYPG      180
181      GIRNSGFPTAWWGEFPEIWRSAAQRAAELDGDTDCAATVADNIAKAQRPEFDFGRRITET      240
241      TEHEGFYVDKSARSRTDRIDVPVLATQSWQDEQVGTRMGYVEETVRPDLLWTVSSNGDHH      300
301      TDLTSADIRELMRRFLARYVKDEDNGFEREPRVRVLQEMQVAGSGEEQTTTPTAVAEFGL      360
361      PVPVTPLRLWFGPDDTLTQAPPAPDTPGAEYRYPVSGSVVNDAPAEGWSPDTAPDGRRAF      420
421      TTAALPQALSFLGAGSVDLWLSSTAPDTDVQVTLSEVRPDGKEMFVQRGWLRASERRLDP      480
481      ALSTELRPWGDFGPDAAEPLTPGEPALLRVELPKFAHTFRPGSSIRITIDAPAQTGFWEF      540
541      DRITTEAVNTVLLDAAHPSSVVLGYTPYPHAPALPSCATTLRQPCRDNTTPVPPGEGPRP      600
601      PA                                                                602

>MER0042813 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 198-447 ( active site residue(s): 259,390,422  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MRVMRTGRLLVSLVAVLVAVAACSSGSEAPDQVSGAWHGVIEVPGQPLAVGIDVTGPDSA       60
61       TIDIPAQGIDGLALRDVRTAPGDVGFVLPGIPGEPTFKGALDREKDRITGDFTQFGQSVP      120
121      LTLEPGELAPPNRPQEPKPPLPYRAEEVTFRSGEITVAGTLTRPEGTGPFPAVVLITGSG      180
181      AQNRDEEIAGHKPFLLLADTLTRAGYAVLRTDDRGVGGTGGDLETSNYDDLADDAAAGIA      240
241      YLRGRPDIAPDRIGLLGHSEGGYLAPLVAARPDSGVAFAILMAGPAVPGGDALIEQTRAI      300
301      LAASGVPAEEIDKQVSDTTEMVGLLRAGDIEGARAVFQRRMAQLPPEMRESMTEADNPIT      360
361      PYYAAFVAYDPAPALAALRVPVFAFFGEKDLQVLPGQNEGPARQLLAAGPDATVRVFPGL      420
421      NHLMQPTATGAIDEYSTIETTIAPEVLTAVTEWLTDRVPPR                         461

>MER0042187 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 93-219 ( active site residue(s): 196,461,515 metal ligand(s): 111,115,198 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MVAVSARGVLWFALGTVVGLIALVLVVVLPSVEDPCEGSSLLGGGPSALPPLGGYPAGDP       60
61       RAADPSPAQANPILTATPSLAAGAGPIRRTLPMAVGTFTISDVFGSRGGGHKGVDMAAAD      120
121      GTPIFSVSDGRVVAAGPASGFGNWIVVDSVDVNGRSYSAVYGHMWDHGVLVRAGDTVRAG      180
181      QQIGAVGSAGESSGPHLHFEIVPGGRFTGGRQIDPMPWLDGAPTPDLGGAQWYSADPRCS      240
241      LGFGSPGGALAPGKVPPELEVWYRRAGSLCPEITPSLLAAQGRQESGFRRGATSPAGAQG      300
301      LAQFLPGTAASASPIDGRPYVLDADGNGAASVWDDGDAIMGQGRYMCSLAAKIRQWQAEG      360
361      RVQGDVTALALAAYNAGEGAVLASGGMPNQYAAHYSETRPYVANILAMEPQYRAPGSLGR      420
421      FTPEEGERGPQILEAAHEWLGTPYVWGGGGPQGPSNGGMDGPGLTAAAVFAASGGEVMLP      480
481      RTAEQQWEFGEEVSMGKAQPGDLVFSDFGPRGPARVGVYAGEGRMIQSAPAGQDSRAGGV      540
541      SEIPVPGDARVRRVL                                                   555

>MER0094387 - PgdS peptidase [C40.005] peptidase unit: 435-532 ( active site residue(s): 196,461,515 metal ligand(s): 111,115,198 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MVAVSARGVLWFALGTVVGLIALVLVVVLPSVEDPCEGSSLLGGGPSALPPLGGYPAGDP       60
61       RAADPSPAQANPILTATPSLAAGAGPIRRTLPMAVGTFTISDVFGSRGGGHKGVDMAAAD      120
121      GTPIFSVSDGRVVAAGPASGFGNWIVVDSVDVNGRSYSAVYGHMWDHGVLVRAGDTVRAG      180
181      QQIGAVGSAGESSGPHLHFEIVPGGRFTGGRQIDPMPWLDGAPTPDLGGAQWYSADPRCS      240
241      LGFGSPGGALAPGKVPPELEVWYRRAGSLCPEITPSLLAAQGRQESGFRRGATSPAGAQG      300
301      LAQFLPGTAASASPIDGRPYVLDADGNGAASVWDDGDAIMGQGRYMCSLAAKIRQWQAEG      360
361      RVQGDVTALALAAYNAGEGAVLASGGMPNQYAAHYSETRPYVANILAMEPQYRAPGSLGR      420
421      FTPEEGERGPQILEAAHEWLGTPYVWGGGGPQGPSNGGMDGPGLTAAAVFAASGGEVMLP      480
481      RTAEQQWEFGEEVSMGKAQPGDLVFSDFGPRGPARVGVYAGEGRMIQSAPAGQDSRAGGV      540
541      SEIPVPGDARVRRVL                                                   555

>MER0402759 - family U72 unassigned peptidases [U72.UPW] peptidase unit: 43-405 (Nocardia farcinica) (Source: MEROPS) 
1        MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGS       60
61       HPEYATAECDSLHQLVTHDRAGERVLEELLIDAEQRLAEEGIGGDIYLFKNNTDSAGNSY      120
121      GCHENFLVVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATFCLSQRAEHIWEGVS      180
181      SATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIEAGVAF      240
241      RDFALDNPIRAIREVSHDLTGRRPVRLAGGRQASALDIQREYYARAVEHLRNRDRDPQID      300
301      QVVDLWGRALDAVEAQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSDPKIAQLDLAYHDI      360
361      KRGRGVFDLLQRKGLAKRITEDEAVDAAVDTPPQTTRAKLRGDFITAAQEAGRDFTVDWV      420
421      HLKLNDQAQRTVLCKDPFRSVDERVDRLIASM                                  452

>MER1047997 - family S51 unassigned peptidases [S51.UPW] peptidase unit: 62-202 ( active site residue(s): 132,167,202  ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MPAERPTILATSMGFHRARDPWQPSPVFRLAFDLAGGPSRPRLCFVTTGTGDRQTSIDAF       60
61       YAAFDGTGVMTSHLALFDKPNMPNVTEHLHEQDVIWVDRGSVVNLLAVWRAHGIDEILRD      120
121      CWTRGVVMGGESAGSLCWFTGGTTDSFGSMRAFADGLSLLPFSNAVHYSDRREHFRSCVA      180
181      AGELPEGYTTEAGAGLHFAGTECVGAFADRKSAAAYRVVRRSDGTVTEDQLEVRRLER        238

>MER0907796 - subfamily M67A unassigned peptidases [M67.UPA] peptidase unit: 4-97 ( active site residue(s): 23 metal ligand(s): 79,81,92 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MLVIKSDLVAAMVAHARADHPDEACGVIAGPEGSDRPERFIAMTNAERSPTFYRFDSGEQ       60
61       LKVWREMDAADEEPVVIYHSHTATEAYPSRTDISYASEPNAHYVLISTRDPEQHELRSYR      120
121      ILDGVVTEEPVRVVDDYDTDDHDTVTPGA                                     149

>MER0911387 - family M79 unassigned peptidases [M79.UPW] peptidase unit: 62-227 (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MAATERGRPLHAYIDVAVVVVVLACTNLIAHFTTAWANIVAVPVAAGILLALVRRRGLGW       60
61       AELGLSPRHWRRGSVYALAAVGVVLAAVAIGALLPVTRPFFLADRYATVSGALIASMIVI      120
121      PLQTVIPEELAFRGVLHGTLDRAWGARGVFAAGSLLFGLWHVASSFGLTSGNRGLSGMLP      180
181      GGPLGQVVGILLAVLATAAAGTVFTWLRRRSGSLLAPIALHWSVNGAGALAAAIVWHTTL      240
241      A                                                                 241

>MER1026553 - family S15 non-peptidase homologues [S15.UNW] peptidase unit: 38-154 (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MATDESIDRGAATAAVQRRDVEFLSDGVPCAAWLYTTPGAPGPRPIVIMGHGLGAVREMR       60
61       LAAFAERFAANGWSVLVFDYRHLGASGGRPRQLLDIGRQLADWRAAVAFARTLPEVDVDR      120
121      IALWGTSFGGGHVLQVGSGNPQVAAIVAQCPFTDGPASLISRLRTGPLSAVALMAVGILD      180
181      TARSWLGSKPILVPMAGTSWMPAFVASPDAIAGASALLPPGTRLSRRSSALLRRLPSVRA      240
241      RLSENIELTIADDREPVTKVGRDSIWGVFRGPGNDFDAANALAARLVLRLPLYRPGRAMA      300
301      RSGVPTLLCVCDNDAAAPAETTKRRARGLAHVRVKTYPCDHFDIYLGTYFEDAVRDQIDF      360
361      LAEQFADTVPAAT                                                     373

>MER0912792 - family M79 unassigned peptidases [M79.UPW] peptidase unit: 104-201 (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MSVRRSGRHAKAAAAVLLPLAWNNRLLPALGLGIRGRTAAHLTFALGYARALGAHPNWLS       60
61       PRGFRAGLLISAVVAAGSAAALTCPRTRAALAAAPDRTPEVRTAEWITVHIPLGTALPEE      120
121      LIFRATLDPLLTTALGPRPALLIGPLTFGLWHIHSARAAGDPILPTIAATTAAGVVFSSL      180
181      YRRTAGAVAPTLVHLTLNTAGAVITTSARKRARRGPPEGIPGRRP                     225

>MER0042330 - Mername-AA223 peptidase [M41.015] peptidase unit: 378-656 ( active site residue(s): 431 metal ligand(s): 430,434,506 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MNRKTVFRTLAIVSGILLVIYAFSYFGDDTRGWQSVDTSVALAQLQDKGNIENVQIDDRE       60
61       QQLRIDLKNGNDATKGADRIIAKYPGGSETSAKIFDAVQSSGAPYNTVVKQDSWLAQILL      120
121      FVLPMVILLGLFLFVMARMQGGGRGGMMGFGKSKAKQLSKDMPKTTFADVAGADEAVEEL      180
181      YEIKDFLQNPVRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEM      240
241      FVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDG      300
301      FGDRTGIILIAATNRPDILDPALLRPGRFDRQIPVGNPDLAGRRAILRVHSQGKPISPDA      360
361      DLDGLAKRTVGMSGADLANVINEAALLTARENGAVITGEALEESVDRVIGGPRRKSRIIS      420
421      EHEKKITAYHEGGHTLAAWAMPDIEPVYKVTILARGRTGGHAMTVPEDDKGLMTRSEMIA      480
481      RLVMAMGGRAAEELVFHEPTTGASSDIDQATKIARAMVTEYGMSARLGAVRYGQEQGDPF      540
541      LGRSMGMASDYSHEVAREIDEEVRNLIEAAHTEAWAILNEYRDVLDDLATALLERETLHR      600
601      KDLEQILASVTKRPRITAFNDFGERIPSDKPPVKTPGELAAERGEPWPPEQPAEPAVPVA      660
661      AQQQREPVPANGYPQQGYQAQPQYAYPHQQGGGYPSPHAPTQAYPRQGGTHGSRPDYGAP      720
721      AGWSAPGWPPRDEAPQQPGAQPGYGGWGRPAEQPQPGGFQPWGDPQHSGRGEDPAHPGSR      780
781      GEDDDNRDWDGPNGRN                                                  796

>MER0041266 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 28-315 ( active site residue(s): 125,264,291  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSTPGSPTSRSAAAMTATRAESPFASGTVVRRGDVELAVFQCGDPAAPPLLLIHGWPDT       60
61       HLLWNEVAARLAGRFRVIAFDNRGAGASTVPAEVAAYRIEELAADVLAVLDAVVPDERVH      120
121      ILGHDWGSVIGWEVVSTPGAAERIASFTSLSGPNLDFLGAYLRGPVSARRLRGALEQGVA      180
181      SAYTVAFQIPGLPVPVMRLLSRRWPRFLAFFDGLDAAAVPAAPTLPADMINNLKLYRANI      240
241      RARLRHPRPRPVEVPVQVLIATGDRAVRPVVHEEAERWVRDLTRTEIRARHWSPLSHPDE      300
301      VAGRTADYIEAITARAGTGTARPGQSEPS                                     329

>MER0041293 - prohead peptidase (bacteriophage HK97) [S78.001] peptidase unit: 20-169 ( active site residue(s): 65,116  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNTKACAVKVKAGPDAGLAEGEFIAYASVFGNKDSYGDVVQPGAFTDTLAAWAAKENPIP       60
61       LLWGHNTADPDFNLGEVVEAIEDFHGLKVHGRLDMESPKSAQVYRLLKSGRVSQMSFAYS      120
121      VIEGEWVEPVGEGKTYKDAYYSLKKLDLYEVSIVPIGANQETEILAVKAAASALRAKAGR      180
181      VLSAKNETTIRDVKTQLEEASQALDEVLAAVATDENTDEQDQTSGKEPSPGKSAQTSAGK      240
241      TTPNPVVSLASLDALAAEIECSA                                           263

>MER0041161 - aminodeoxychorismate synthase, subunit II [C26.955] peptidase unit: 23-214 ( active site residue(s): 83,172,174  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRVLVVDNYDSFVFNLVQYLGQLGTDAVVWRNDDQHLADLDAVAADFDGILISPGPGTPD       60
61       RAGASIDLVRACARTATPLLGVCLGHQAIGEAFGATVTRAPELLHGKTSSVFHVGAGVLA      120
121      GLPDPFTATRYHSLTVLEDTLPAEIEVLGRTESGIVMAMRHRELPIHGVQFHPESVLTQG      180
181      GHRMLANWLGVCGSRPPEGLVEMLESEVAALVPQ                                214

>MER0458606 - glutamate synthase (NADPH) large chain [C44.003] peptidase unit: 25-410 ( active site residue(s): 25  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MTQLPGHRSPGPIGLYDPANEHDACGVAFVVDMHGRRSRDIVDKAITALLNLEHRGAAGA       60
61       EPNSGDGAGILIQIPDRFFRAIVDFELPPEGSYASGIAFLPQARREAARAAYGVEKIVKE      120
121      EGLEVLGWREVPIDDSSLGALSRDAMPTFRQIFIASPRTGAEQLSGMDLERRAYVIRKRV      180
181      EHELGTQGAGEGATGRETVYFPSLSGQTFVYKGMFTTPQLRAFYLDLQDDRVESALGIVH      240
241      SRFSTNTFPSWPLAHPFRRVAHNGEINTVTGNENWMRAREALLNSDVFGTDAAGKNRLEK      300
301      IFPVCTPGASDTARFDEVLELLHLGGRSLPHAVLMMIPEAWERHDSMDPQLRAFYEYHSM      360
361      LMEPWDGPASVCFTDGTVVGAVLDRNGLRPSRIWVTDDGLVVMASEVGVLDIDPAKVVRK      420
421      ARLQPGRMFLVDTSQGRIVDDHEIKTQLAAEHPYQQWLDEGVTRLADLPDRPHVHMSHDR      480
481      VLIRQQIFGYTTEELSLLISPMAKTGGEALGSMGTDTPIAVLSSRPRLLFDYFSQLFAQV      540
541      TNPPLDAIREEVVTSLKRNLGSEADLLHPGPESCKQIAIEQPILDNDELAKLVHINDDGS      600
601      QPDLRSVVVRGLYPVKKGGKGLRKALQAINTQVSAAIEGGARIIVLSDRESNEKLAPIPS      660
661      LLLTSSVHHHLVRERTRTKVGLIVEAGDAREVHHMAMLVGFGAGAINPYMAFETIEDMLE      720
721      RGALDLGTGDLASDYRKAVANYIKAAGKGVLKVMSKMGISTLASYNGAQLFQVIGLSQEL      780
781      VDEYFTGLRSHLDGIGLDEIADDVAARHRIAFLENRNERAHRELEVGGEYQWRREGEYHL      840
841      FNPDTVFKLQHATRTGQYSIFKEYTKLVDDQSERLASLRGLFKFKKGERAPIPIDEVEPA      900
901      SEIVKRFSTGAMSYGSISAEAHETLAIAMNRLGGRSNSGEGGEHPARFEVEENGDWRRSA      960
961      IKQVASGRFGVTAHYLTNCTDIQIKMAQGAKPGEGGQLPAHKVYPWVAEVRHSTPGVGLI     1020
1021     SPPPHHDIYSIEDLAQLIHDLKNANPQARIHVKLVAEPGVGTVAAGVSKAHADVVLISGH     1080
1081     DGGTGASPLTSLKHAGGPWELGLAETQQTLLLNGLRDRIVVQVDGQMKTGRDVMIAALLG     1140
1141     AEEYGFATAPLVVSGCVMMRVCHLDTCPVGVATQNPVLRERFTGKPEFVENFFLFIAEEV     1200
1201     RELLAQLGFRTLDEAIGRVDLLDTSKAKQHWKASKLDLSPILDDIETAFMFQDRRCTKSQ     1260
1261     DHGLDRALDQQLITEAREALERGKPVKIDTKITNVNRTVGTMLGHEVTKLYGGAGLPDDT     1320
1321     IDITFTGSAGNSFGAFVPAGITLRVQGDANDYVGKGLSGGHLVVRPAPNAPAEFVADQNI     1380
1381     IAGNVILFGATSGKAFISGVVGERFAVRNSGATAVVEGVGDHGCEYMTGGRVVILGETGR     1440
1441     NFGAGMSGGVAFVYDPNGTFAARVNPEQRDALEPLAGDDFTWLRDIIAEHRDKTGSAVAD     1500
1501     RILSDWSQQVNHFVKVMPREYKKVLLAISEAEKSGKDVDEAIMEAARG                 1548

>MER0211280 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 71-331 ( active site residue(s): 188,284,326  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRGRRARGWFQRALLLSMAVLMPLGVTVAGGGATASAAFNPDGFDFWVDSDMGPIKSRIF       60
61       RAADGNTNRVVYALDGMRARNDLSGWEIDTEVARELTKWNINVVMPVGGMSSFYADWNAP      120
121      STILGIGGGSSGSASGSSSGSGALQMFAGGPGKSTRYTWETFLTNNLRWALRDRLGFNPN      180
181      RNGVFGLSMGGSAALTLAAYHPDQFSYAGSYSGYLNVSAPGMREALRVAMIDAGGYNIDA      240
241      MAPPWGPQWLRMDPFVFAPRLKANNTRLWISAGSGLPGPADGFNFGTVNAMGLEVLALAN      300
301      TRAFQVRMATLGANNVTYDFPAVGVHNWRYWETEVYRMIPDLSANIG                   347

>MER0210614 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 82-337 ( active site residue(s): 194,290,332  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRSLRWKRRPTRASGAKSWTRRAALAVATAVLVPLGVTVAGTGATASAAFDPAAFDFWVD       60
61       SGMGPIKSRILRAADGNTNRVVYVLDGMRAPETLNGWEIETDVPALLASWNINVVMPVGG      120
121      MSSFYADWNAPSEFFGIPAGSGSSSGSGALNAFTGGPGKSYRYQWETFLTNELRWALRDR      180
181      LGFNPNRNGVFGLSMGGSAALTLAAYHPDQFSFAGSFSGYLNISAPGMREAIRVAMLDAG      240
241      GYNVDAMAPPWGPQWLRMDPFVFAPNLIRNGTRLWIAAASGLPTSTDPPSFNTLNGMGLE      300
301      ALALANTRAFQVRMATLGGGNAVYSFPPFGIHAWNNWRDEAVRMMPDLSANIG             353

>MER0041213 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 108-329 ( active site residue(s): 205,298,329  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLRRSLLRGLLKCKCVRCRRRHSLVRHRAVRPGRCGGAAARRCAMVVLNPEGPSAQARLL       60
61       TAACRGVVRPVLRAAPITRATIPVGALAIDGLARLRPHPRGIEREQVTMPGFAMEIIRPA      120
121      GAARAMRHGALLYLHGGGFAVCGLETHRPVAASLARRTGLPVVNVAYRQLPVRSITESID      180
181      DCLAAYRWLLRHGAEPDRIVFAGDSAGGYLTFATALRALECGLPAPAGLVGLSPLLDLDY      240
241      AAKRDYVNVARDPYIPLSALAAVVRLGAEREGRLDPLLSPVNGALAHLPPVLLVAAEDEV      300
301      LRFDAELMAARLDAAGVPNSVELWRGQVHAFMSIAPGLPESRAALGRVARFVRGRLADSQ      360
361      RARTA                                                             365

>MER0041270 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 19-568 ( active site residue(s): 232,506,535  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTGPGVAAQDVHVGRWRIALVVVAMLPLAAGCAGAVQQQTALGQLAAQADAAATPRLDW       60
61       TDCAEQQLAGYECAAARVPLDYARPDGETIELALVRQRAGDPQRRLGTLFAAAGGPGNSG      120
121      LDWARGGPMFPGEISRRFDVVTFDQRGVGASAPVRCFADAAEQERFWSTMVLPPADAEQQ      180
181      LAAERAARAYAEGCARHSGALLPHLTTVDAARDLDLLRRAVGEDRLTFTGGSYATYLGQV      240
241      YGALFGERVRALHLTSVIDPAVYGGDTRAEIAGTAAGTAEVFEEFLRLCAQGGRPECAFA      300
301      EGGERSELVGESGPGAAEKAGSSGTERPSVTLTTAAGPAEADVERLRARDAALLERLRTG      360
361      PITVGTGEQAVRVGYAEVVQAHALLLYDPRQGWPALAGLLAELDRGPHGDPAPVRQALAG      420
421      GATPLDFLDSFTAITCADATLPRDPARWPALAQETPAATPDFDDFWLYMRQPCAAWPTPE      480
481      QDARHVAGPWTLISDKPALLVNNRYDPATPLEFARRAQQELVNARLVVVEGGYGHEPGGE      540
541      CVRSLRERYLIDLQLPAPGATCTADRAPFAS                                   571

>MER0041231 - GYO_0385 g.p. ({Bacillus subtilis}) [S12.A23] peptidase unit: 89-268 ( active site residue(s): 91,94,182  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAAVTLVAGALAGAAQAAPDPGYAECAVTSGRTPQRAAPEAAGFDSGRLDEALRFAAERN       60
61       RFNVQVFRHNCLVGEGPNNAHTGHVPWNIWSSTKSVVSLLAGMAAERGLLDLHAPIDRYL      120
121      PAGLGDAEHRSITVEDLLTETSGMRVGVLTEGITGVIPIDPHSAVQALGVPLANPPGTVF      180
181      SYSQRNVDLLAYVIELALGEPLQQFAQRELFDPLGIAREDYYWARDRAGNTYGYAHLMLP      240
241      PDDFAKLGLLVADDGRWGAQQIVPADYLRQARTPSPANRCYGYLFWLGPGCAEIPAFLPS      300
301      GVYAMAGLGLQNVFVLPELDLVVVWTGAFGNVSAHGVQGIVQNTGELPWEFFRKLFAAMH      360
361      EPPVPDPGPYVEPPLRTDPSRYVDNSLLLAVFGVGPAAYPGCNVFSCLNYELAAPFADAP      420
421      PGCYVLACLGPDPRTPGIR                                               439

>MER0041203 - MarP peptidase ({Mycobacterium tuberculosis}) [S01.513] peptidase unit: 219-367 ( active site residue(s): 234,263,341  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSSVWLDVVVVVLALAAAASGWRQGAVASALAFLGVVLGAVAGILIAPHILVHVDEGRT       60
61       RVLTGVLLIVVLVIVGEVAGMVLGRAARSGMRHPFTRSVDSIVGAALQAVAVLVIAWLLA      120
121      LPLATSSQPAIASAINGSRVLADVNEVAPNWLRKVPNEFSRLLNTSGLPDVIGPFGRAPI      180
181      AAVEPPDPSVLASPVAASLQQSVLRIRGVAPSCQRALEGSGFVIAPERVMTNAHVVAGTT      240
241      SVSVDTARGPLEASVVLFDPSKDIAVLAVPGLTAPVIPQASAAARSGDSAIVLGYPGGGP      300
301      YTASAARVRETLDLTGPTIYRNGTVEREVYTVRGLVRAGNSGGPLVDTQGQVLGVVFGAA      360
361      VTDDDTGYVLTLSEVRTELEAAPGATLPVDTGGCVLS                             397

>MER0041262 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 10-303 ( active site residue(s): 116,263,291  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSPTPPDPSTVRYDGPWTHRDVHANGIRFHVVEAAPERTDAPLVVLLHGFADFWWSWRHQ       60
61       LTGLADLGYRAVAVDLRGYGDSDKPPRGYDGWTLAGDVAGLIRALGHTEAVLVGHAEGGL      120
121      VCWATAVLHPRLVRAIALVSSPHPAALKAAVLTDARQRRAWLPAFLRCQLPRLPEHRLTT      180
181      ADGFEVERMLRRRVGAQWAGTSEFVDTARRMRTAIRIPGAAHCALEYQRWAFRSQWRPDG      240
241      RRFMATMRDPIDIPVLSLRGEHDNYLLRPTFHRGHRWAPHRRLVTVPEAGHFAHQENPDV      300
301      VTTELAKFLA                                                        310

>MER0038142 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 13-240 ( active site residue(s): 102,212,240  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTKNNTSTWTCTVAVDDTALAVTDTGGAGLPVVYLNGQFATQGYWRKVIADLGPEFRHIT       60
61       YDERARGKSRRSADYSFEAAVRDVDAVLAARGVARALLVGWSYGAVVAAHWAQRNPDRTV      120
121      GAVLVDGAFPYDWLDDAMERRITTLFKRLNLVMPLLRPTGLTPRMNAAQMAASNIELGKL      180
181      SRERELGPVLDDIRVPVRYVVASGTSFGSRGDEQERIRSGLDAVCGRNPHIRVSAKVAGN      240
241      HGALLRKDFRAISAAVRETAHPGGPSSVASTMSR                                274

>MER0041284 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-346 ( active site residue(s): 151,303,334  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTADTKECAMLVTSMKTLAGVRSTEPLTAAYRAALRSRTYATASLNKPAAPVEIVPVTTV       60
61       DGARLRVHAYGPADGEVIVLIHGWSCCIEYWHPQINALADRYRVICYDQRGHGESTLGRV      120
121      APCADTLADDLATVLDATLPRGRRAVLVGHSMGGITLQAWAARYPEQVPDRAAAVVLANT      180
181      ASKDIRFETDLLPLLNKPLAVANRPLTVFGRGVRMPMVLAETLLTAPVPLPGGPMSPLVT      240
241      AVLKSRVMTRNATADQAAFALGIVRSCRPLTRGLHAAALADMDLGDAAKNLTVPTTVIAG      300
301      LHDHLLPERMNRTIVEALKSSGSLADYQVWPTGHLSNVEAADRFNAELAKIAASAYRPQA      360
361      DAV                                                               363

>MER0041186 - lysyl endopeptidase ({Streptomyces albulus}) [M01.033] peptidase unit: 260-422 ( active site residue(s): 306,381 metal ligand(s): 305,309,328 ) (Nocardia farcinica) (Source: MEROPS) 
1        MRSADGREVLMGDKFYDEPIDDYLPQNGNRGYRVSRYELDLVYKVAGNRLSGRAEITAVT       60
61       TAVRPRFAFDLAQSLSVAKVFVNGAKVARYTHRNGKLVLTPQQKIPAGGVLAVVVQYAGA      120
121      PKPVRGPWGEVGWEELTEGALVASQPNGAASWFPCDDHPSSKASYRISITTDSPYHALAN      180
181      GTLVRKQTKASQTTWVYEQPEPMSSYLATIQIGPYRRHRIGSEQSPVPMYAVLPARLRAA      240
241      FDTDFARQQRMMEVFTDLFGPYPFAGYTVVVTDDDLEIPIEAQGISIFGANHCDGRRGSE      300
301      RLVAHELAHQWFGNSLTLRRWRDIWLHEGFACYAEWIWSEAAGGPSADQLARAARHNLSR      360
361      EPQDLVLADPGPALMFDDRVYKRGALTLHALRIELGDRAFFDLLREWTGRYRHACVDTEE      420
421      FTDLAGHYSQVPLRPLWDSWLRETALPPLPPHGGQAVTVPR                         461

>MER0041238 - penillin-binding protein 4 [S13.004] peptidase unit: 73-475 ( active site residue(s): 114,117,292  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAARRRRRLWIGATAAATALLLAVAAVLLVVRPWTPEFRHGGLTVAAPPAPVKAFPRVTP       60
61       ATEAPAPSPAGVSTALAAAVTNPDLGAFTGIVTDAESGVTLWSADPGRPMIPSSTAKILT      120
121      AAAALLALPADRRVATEVVVGSAPGELVLVGGGDPTLTAQPDGKGYYPNAARLSDLVDQI      180
181      KASGRAVDTIVVDTSAFSGPTMARGWDPIDVPEGSIAPIEPVMIDGGRLSPLVEYSPRTT      240
241      EPALDAGRALATALGLDPARVRAGTAAPDAAEVAAVHSAPLRDRLRDMMVHSDNVLAETI      300
301      GREIALATGHEPSFTGAVAAVRATLEKAGFDVSGMDMHDTSGLSVDDRLPARLLDKVIAT      360
361      AAQPTGTALARPAGTKAEPESDRLAATLAPLLDQLPVAGATGSLAERYVTRNREGAGWVR      420
421      AKTGTLTVASALVGYVLDRDGRVLTFALMSNDRPPEVSRPALDAIAGTLRNCGCS           475

>MER0041265 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 11-227 ( active site residue(s): 80,168,224  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLYDEGGAGAPILLLHGLMGSARTWAGHLDWLRGHGHVYTFDAAGHGRPAPPELTTEAFV       60
61       ADLAEATAGIGEPMAVIGHSMGGLHGWVFAAHHPERVRALVVEDIAPDFTGRTAADWAAM      120
121      IESWPQPFPDADAVLSYFGPVAGRYFLNSFEHGPQGYRLHGSVATFRDISEEWGGRSFWA      180
181      EWRAVRVPALLIEGEHTITPPGQMREMAAVNPHAEYVRVAGAGHLVHDEQPRRYRAEVAR      240
241      FLDRVLGAP                                                         249

>MER0041244 - DNA repair protein RadA ({Escherichia coli}) [S16.A04] peptidase unit: 282-434 ( active site residue(s): 368,411  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAKTKAIFRCSACSHEVAKWVGKCPDCGAWGTVDEVAVSAGAPGAPGRRAMLPSTAAAPI       60
61       SAIDSQVTKARPTGVSELDRVLGGGVVAGSVVLLSGEPGVGKSTLLLEVAHQWARRPGEK      120
121      ALYVTAEESAGQVRLRADRTGAVHEQVFLAAESDLSIVLGHVEQVRPTLLVVDSVQTMLA      180
181      PEAEGVIGGVTQVRAVTAALTSLAKASGIAVLLVGHVTKDGNVAGPRTLEHLVDVVLQFE      240
241      GDKNSTLRMVRGIKNRFGSADEVGCFELHEDGIACVDDPSGLFLHHRTDPVPGTAVTVAM      300
301      DGKRPLVGEVQGLTVKTEIPAPRRAVSGLDYNRVAMVLAVLQSRGRVFLGKHDVYAATVG      360
361      GMRLAEPAADLAIALAIASAECDTALPAGWVILGEVGLAGEVRKVTGVARRLAEAERLGF      420
421      TTALVPPGSERLKGATIRVHEVGDVRSALRISGLRGRKSGGD                        462

>MER0041255 - 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase ({Burkholderia}-type) [S33.016] peptidase unit: 17-280 ( active site residue(s): 113,240,268  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSTAELTYESTSRYAQVRPDLKLHYHEAGVGNGPTIVLLHGGGPGASSWSNFARNIPVL       60
61       AQNFHVLAVDQPGFGRSDKPVDHPQYFSHSAAALKDLLDTLGVTERVHLLGNSLGGGAAV      120
121      RFALDYPDRAGKLVLMGPGGLSMNAYAPDPTEGVKLLSRFNFEPTRQNLEAFLRIMVFDQ      180
181      KLITDELIDERFASAATPEALAATRAMGKSFAGPDFELGMLWRDAYKLRQPVLLIWGRED      240
241      RVNPLDGAIVATKMIPRVQLHVFGGCGHWAQLEKFDEFNRLATDFLSGPGKES             293

>MER0041230 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 11-383 ( active site residue(s): 64,67,153  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQAIEVHGTVADGYEQVRAEFAAVVAEEDGESGAQLAAFVRGRKVVDLWAGREVSGTTLT       60
61       GLHSTSKGAAGLVVALLIQDAALDVDRPVAHYWPRFAAAGKDRITVRDVLVHRSGVVGAD      120
121      GGFTVDELADERVVAERLVGQRPFFEPGSVHGYGGFVTYAIIGEVVRAVTGSTIQEHFEQ      180
181      RIRAPYGLDVYLGLPAELDHRYLPILPWRATPEMEAAFAANSPNPHGIAGVSYNLNARGF      240
241      TAADVMALPNDAKLRRLGQGSAGGVGSAHGVAAMYAAATTGIGDREPLLSLETIATISAI      300
301      HSHGPDLVRGDRVAYSLGFEAKSLLYPFLGAHAFGHTGSAGSDGFADPHSGLAYGYTRRR      360
361      AAFAFNAPENARLAAALHRAATTTGLATAA                                    390

>MER0041181 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 34-145 ( active site residue(s): 79,104,105  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQIAVYAFDGFPMFHLAVPLTVFGEVGRLGLAADWQTRLWSDRAGSVRTAEGYPIGDVAG       60
61       PEILASADIVVVPSWLQSLAPAGDDLKNQLIDAHRRGATIAGLCFGAFPLADAGLLDGRA      120
121      AVTHWEVLPLLAERRPDTSVDASVLYIDHGDVLTSAGTASAIDACLHLVRKHLGVAAATR      180
181      VARSLVVAPHREGGQAQYIERPLARPATDGAIGEVLDWALAHLDHPLTVDLLAERARMSR      240
241      RSFVRHFQQATGTTPARWILDRRLDEARALLETTDWPVDTIASACGFGSPVTLRQNFAAA      300
301      YGTTPTTYRRRFAPTPA                                                 317

>MER0041278 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 23-269 ( active site residue(s): 105,229,257  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPLATVNGISLNYQVKGDRAKGTEAKGSAPLVVMIMGTGSPGRVWELHQVPALLAAGYRV       60
61       CTFDNRGIAPSFEAADGITIDDLVGDTAGLIELLDEGPALVVGTSMGARVAQELALARPD      120
121      LVRKAVFMAGHGRLDQFQKTLSLGEHDLDASGITLPPKYEAAVTAVMNLSPATLADANAA      180
181      RDWLDLFEFTGGPVTPGIRAQRRMDHDFDRVQAYRGITVPCLAVGFADDRMIPAYLTREV      240
241      AEAIPGARYQEVPDAGHFGYLERPEIVNKILLDFFAA                             277

>MER0042184 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 160-325 ( active site residue(s): 301 metal ligand(s): 222,226,303 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVGVMLDKARRAGLDRVREAGGIVVVPPDWRTRARPRTTAAGRDLTALWRRARREARALR       60
61       RGPRPDPRRWWTEQKKAEYRALLRTHKWLIAGLAAVLLVAAADGVASRPGTGPLGPNEAQ      120
121      RVFFAHPQQFQSTPPSVRRYLNAIANGERLREQAVVAAAARATLERAKAEAAAAAAGEWQ      180
181      PWINEPGTVIVPGSVIPDISGFVLPARGMFTSGFGSRWGTFHNGIDVAGPIGTPIYAVAA      240
241      GTVIDAGPAQGFGLWVRIRHDDGAITVYGHMYDFFVSVGERVPAGMQIARMGNRGDSTGP      300
301      HLHFEVIVNGRHVDPRAWLAARGLSY                                        326

>MER0211245 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 71-302 ( active site residue(s): 159,246,297  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRRRRIAGAVLAAVLAVLGPLVAVQAPASAAQVVRVDELSPTRSAVFVDSPAMGRVIQVQ       60
61       VLHPAGGAARPSYYLLDGLDPGVGQSTWTNATDAEAFFRGKNVNVVLPVGGQASYYTDWQ      120
121      TDDPKFGRYKWETFLTRELPPIIDAQFAGNGVNGIGGLSMGGNAAYILAARNPHLYTAVA      180
181      GYSACPDTGLATGAVMFSIANRGGNPLNMWGPPGSPAWAEHDPARLAGNLRGKTLYLSTG      240
241      TGIPGPHEAELKPQLAENIFLGGPVEVGVNICTVAFEQRLRGLGIPARIDYSPVGTHSWS      300
301      YWQDTLHASWSTIGRALGA                                               319

>MER0041208 - oligopeptidase B [S09.010] peptidase unit: 430-716 ( active site residue(s): 567,653,688  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSVESGVAAPIAKRVPTERVHHGDVFVDEYEWLRDKENPEVIAYLEAENAYTEAQTAHLS       60
61       GLREKIFEEIKSRTQETDLSVPTRMGEYWYYSRSFEGKQYGVHCRCPIDTTADAAAAWNP      120
121      PQLEAEGEIPGEEVLLDSNELAEGHEFFALGAFSVSHDGTLLAYSVDTVGDERYTLRIKD      180
181      LRTGELLADEIAGTAPGATWSLDGTHVFYQTVDESWRPDTVWRHRLGTGTDADVRVFHEP      240
241      DERYWVSIGATRSEKYLMIWVGSKITTEGWVLESDDPEGEFRVLLPRREGVEYSAEHAVI      300
301      GGQDRFLILHNDVVDGVKAQNFVLAEASVDNPADLRILIGHRDDVRLEDIDAFADHLVLS      360
361      YRREALTRLAVWPLTETGYGDLRELEFDLELFAVGMGGNPEWAQPTLRLGLTSFITPMRV      420
421      YDYVPATGELLLRKEQPVLGGYDAGDYRQRREWAVAADGTRVPISLVWKTGVADPGVEPR      480
481      PLLLYGYGSYEASMDPSFSVARLSLLDRGMVFAVAHVRGGGEMGRLWYENGKTLTKKNTF      540
541      TDFVACARHLIDTGVTAPDRLVADGGSAGGLLMGAVANLAPELFAGILANVPFVDPLTSI      600
601      LDPSLPLTVIEWDEWGNPLADKDVYEYMKSYSPYENVEAKDYPAILAITSLNDTRVLYVE      660
661      PAKWVAKLRATKTGDAPLLLKTEMSAGHGGVSGRYAKWKEVAFEYAWVLDTAGLGE          716

>MER0041193 - subfamily M20F unassigned peptidases [M20.UPF] peptidase unit: 1-454 ( active site residue(s): 97,160 metal ligand(s): 95,129,161,187,426 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSEEPHVAALRARVAGLMGQAKQDLTQLVSFKSVADARQFPPQECEDAAQWVADACASV       60
61       GLTDVGLHETPDGTKAVIAARPAPPGAPTVLLYCHYDVQPPLDEAAWRTPVWTLTEREDG      120
121      RWYGRGAADCKGNIVMHLTALRALGPDLPVGVTLVSEGSEEQGTGGLEKFVVANPELLRA      180
181      DAIVIGDCGNFAPGVPTLTETLRGNVNVVVTVETLAGPMHSGMFGGAAPDAMTALVHLLA      240
241      TLHDADGNTTVAGLAADQGWDGVQYPPEQFRLDAGVLDGVDLAGSGTVSQMLWARPALTI      300
301      LGIDAPPVVGSAAAVQAVARARLNLRIPPGVEPEDAHRALVAHLHAHIPLHARLTVELEG      360
361      LGAPFRSSTGGPARAAMEAALTAAYGRPTTTQGQGGSIPLCNVFAETYPAAEIMLLGVEE      420
421      PSCLIHAPNESVDPAEIERMALAEALFLRDYAAR                                454

>MER0180593 - family C26 unassigned peptidases [C26.UPW] peptidase unit: 4-198 ( active site residue(s): 87,196,198  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MSARIGVITFPGTLDDVDAVRAVRLAGAEAVNLWHADADLKQVDAVIVPGGFSYGDYLRA       60
61       GAIARFAPVMGEVVRAAEQGMPVLGICNGFQVLCEAGLLPGALTRNEGLHFICRDQWLTV      120
121      ESVSTAWTSRYEPGAQILIPLKSGEGRYQAAPAVLDELEGEGRVVFRYSGDNPNGSQRGI      180
181      AGISSANGRVVGLMPHPEHATEALTGPSDDGLGLFLSVLDTLVTA                     225

>MER0041191 - aspartyl aminopeptidase [M18.002] peptidase unit: 3-429 ( active site residue(s): 86,263 metal ligand(s): 84,231,264,309,403 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPVATTDATAAGLCAFVDDSPSPFHVCHTVAGELEAAGFTRLSESAAWASGEPGRYYVVR       60
61       GGSLVAWADRDGSPSAPFRVVGAHTDSPNLRVKQHPDLASAGWQLVGLEPYGGAWLNSWL      120
121      DRELGLSGRLTVREGNSVRARLVRIDDPILRVPQLAIHLSEDRRGVSLDPQRHVNAVWGV      180
181      GEKPRSFLAFVAEYAEVDPDAVLGWELMTHDLAPSRLVGRDRDLVSAPRLDNQGTCYAGL      240
241      RAFLAAVAEPGTAIPVLAMFDHEEVGSQSDRGAQSDLLPAVLERIVLARGGGRAEYLAAL      300
301      AGSVCASGDMAHATHPNYPERHEPAHRIEVNGGPVLKVNQNLRYATDATGAGAFALACAQ      360
361      AEVPLQRYVHRADLPCGSTIGPMTAARTGMPTVDVGAPQLAMHSARELMGAADVGAYAAA      420
421      LAAFLTPDG                                                         429

>MER0038384 - At4g38880 ({Arabidopsis thaliana}) [C44.A02] peptidase unit: 1-247 (Nocardia farcinica) (Source: MEROPS) 
1        MFGVWAPSEDVAKLTYYGLYALQHRGQEAAGIAVSDGQQILVFKDLGLVSQVFDEQTLAA       60
61       MPGHIAVGHCRYSTTGGVTWENAQPIFRTTAVGSGLALGHNGNLVNTAELAGRARELGLI      120
121      GTPVSGGRPQPVGATSDSDVMTALLAHAAADSSIEQAAMELLPQLRGAFCLTFMDEHTLY      180
181      AARDPHGVRPLCLGRLDRGWVVASETAALDIVGAAFVREIEPGELLAIDAEGVRSMRFAN      240
241      PEPKGCVFEYVYLARPDSTIAGRSVHATRVEIGRRLAKEHPVEADLVIPVPESGTPAAVG      300
301      YAQGSGVPYGQGLMKNAYVGRTFIQPSQTIRQLGIRLKLNPLREVIRGKRLIVVDDSIVR      360
361      GNTQRALVRMLREAGAVEIHVRIASPPVKWPCFYGIDFASRAELIANGGGADDSYDDMVE      420
421      AVRRSIGADTLGYISTEGMIAATEQPRTRLCSACFDGQYPIPLPTEASIGKNLLEGMLTG      480
481      QPESVLLGDNANASALSRP                                               499

>MER0041185 - family M1 unassigned peptidases [M01.UPW] peptidase unit: 295-455 ( active site residue(s): 335,412 metal ligand(s): 334,338,357 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNPLPCWSSRCDRTGAGHGRKGWWRVRWAVLAGVATLGLVLTGTGAAPAGADPFVGAPGL       60
61       DDPYYPLDGNGGYDVRHYDVRIGYDPPSRWLDGTARIDAVATQLLRAFNLDYSGPPVDAV      120
121      TVNNQPAAFERHGEHELTVTPLLPLLPGLPFTVTVHYAGPAADTAGAGWTLTPSGGAFAA      180
181      GQPHSASTWYPLNDTPRDKATFALHATVPAEWEVVSNGVRTENTVRDGSRTVGWASAHPV      240
241      IGYLTTIAIDRFSFLEQARANGTPILSAFAPAAERNRATEQRLPEILDFTEELFGPYPFD      300
301      AAGGIYVDADLSFSLETQTRPVYAPWTDLATVVHEIAHQWWGDSVSVRSWSDICLNECFA      360
361      SYTADYLWPERMDGVDVDARYRETVAEFHDNPRFWEIPLENPGAGREFTSVYYRGPLFLH      420
421      ALRRQLGDEVFFPALREFLATHAYGNASMPELRTFLQSKSATDLTGFFTAWLNDTAPPPA      480
481      EYLYPGTLGTPDR                                                     493

>MER0042812 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 25-373 ( active site residue(s): 127,314,341  ) (Nocardia farcinica) (Source: MEROPS) 
1        MATDESIDRGAATAAVQRRDVEFLSDGVPCAAWLYTTPGAPGPRPIVIMGHGLGAVREMR       60
61       LAAFAERFAANGWSVLVFDYRHLGASGGRPRQLLDIGRQLADWRAAVAFARTLPEVDVDR      120
121      IALWGTSFGGGHVLQVGSGNPQVAAIVAQCPFTDGPASLISRLRTGPLSAVALMAVGILD      180
181      TARSWLGSKPILVPMAGTSWMPAFVASPDAIAGASALLPPGTRLSRRSSALLRRLPSVRA      240
241      RLSENIELTIADDREPVTKVGRDSIWGVFRGPGNDFDAANALAARLVLRLPLYRPGRAMA      300
301      RSGVPTLLCVCDNDAAAPAETTKRRARGLAHVRVKTYPCDHFDIYLGTYFEDAVRDQIDF      360
361      LAEQFADTVPAAT                                                     373

>MER0042185 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 78-244 ( active site residue(s): 219 metal ligand(s): 140,144,221 ) (Nocardia farcinica) (Source: MEROPS) 
1        MRAAASAAVAAGALVGVAAQVAPALAAASPLAPSRNTEAAEETIAFKGTAEIPAAEAKQI       60
61       AEPAPAADPAPVTQVAAPVAQNVAQQPFGIPNLPPEIAAPLAQVEDVLKNVQQHVAPPVA      120
121      VRPVAGAISSGYGTRWGQFHYGLDFADALGAPIRSVSSGTVIEAGPASGFGLWVRVLQDD      180
181      GTTAVYGHVNDMYVQAGQRVNAGDVIATVGNRGQSTGPHLHLEIWDQGGNKIDPMPYLAA      240
241      KGVPMHWGPSAH                                                      252

>MER0209551 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 82-323 ( active site residue(s): 170,260,318  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MIATTAVFAGLMSGLGASSATADPIIDSKALLANPTAPDGSKITKAEIKDDRNLRLYVYS       60
61       AAMDENVIIDVQRPADASVPRPTLYLLNGAGGGEDDASWVAKSDALKFLSDKNVNVIQPI      120
121      GGKWSYYTDWIKDDPTLGRNKWKTFFTEELPPLVDGALGTNGINAIAGLSTSGTTVLALP      180
181      IAKPGLYKAAAAYSGCAQTSDPVGSEFVKLTVETWGGGDTENMWGPPGSEEWVKNDPYVN      240
241      AEGLRGLELYISTGNGIPGPYDTLNGPYALPGSYGLANQILIGGVIEAGTNYCTNNLKTR      300
301      LDELGIPATYNFRPNGTHSWGYWNEEFPKSWPVLAKGLGL                          340

>MER0042238 - subfamily M24A unassigned peptidases [M24.UPA] peptidase unit: 9-266 ( active site residue(s): 86 metal ligand(s): 104,115,184,217,248 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVFGRKNKKVVPFRTAGELDAMAAAGAVVGRALVAVRAAAKPGVSTLELDEVAEQTIREA       60
61       GAVPSFKGYHGFPGSICSSVNDRVVHGIPSAEEILAEGDLVSIDCGAILDGWHGDSAWTF      120
121      GVGSIIEADRLLSEATRISMEAGIAAMVPGNRLTDVSHAIELGTRAAEQEHGRAYGIVDG      180
181      YGGHGIGREMHMDPFLANEGEPGRGPQLVVGSVLAIEPMLTLGTTQTKVLDDDWTVVTVD      240
241      GSRAAHWEHTVAVTEDGPRILTPRPE                                        266

>MER0041206 - mycosin-1 [S08.131] peptidase unit: 48-401 ( active site residue(s): 106,137,253,345  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNRRLGLRRGAGTVGAAVVLGAAVFALPASAAAIGPPVVDDGALGAALAISGRPAPLEPT       60
61       EQRSVCAEPILTGAPPVEPPLAQAVLDLPTAWQFSRGAGQKVAVIDTGVNRHPRLRALQA      120
121      GGDYVADTDGTVDCDGHGTLVAGIIAAAPSPDDAFAGVAPDAEILAIRQLSLAYEPKDRR      180
181      SGEQSGAITTSGYGNVLTLAGAVVRAVDMGATVINISEVACSAAGATPEDAALGAAVKYA      240
241      FDRNVVVVAAAGNLTSEGACKTQNERPGWSSVQTVASPAWFDPYVLSVASIDPNGMVSEL      300
301      SLHGPWVRAAAIGRRIVSLDSKPGATGLVDGVQTSEGISPIEGTSFAAPYVSGLVALVRA      360
361      RFPELNAAQVIDRVVRTAHAPGTGRDDKLGHGLIDPVAALTAELPDQPVHAGADTPRPLA      420
421      EPARPPGPDPLPRRVAVIGSITSLAVLGVGAALSIPFRNRRELDLDHLDREVLDREVTEG      480

>MER0041205 - mycosin-1 [S08.131] peptidase unit: 44-386 ( active site residue(s): 86,118,233,330  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSASFGIGANAGVAHADRPPAVNPGLKPPGDPAAPPEKTERPANSACADILTGGDGPTIP       60
61       EAQRALDLERAWKFSKGAGQRVAVIDTGVARHPRLPGLEAGGDFVANSGDGTEDCDGHGT      120
121      LVAGIIAASQVEGQGFAGVAPEAQIITIRQTSKMYQKEGRSAEKAPDEFPDSYGNLNTMA      180
181      SAIVRAADLGATVINISEVWCGTGSPDADNKVGAALHYAAIEKDVVVVVAAGNKDDKCKG      240
241      ENQVIDPLDPTADPWSKVTYNISPARWDDYVLSVGSIDANGAPSSFTIPGPWLGVAASGE      300
301      NMVSLDPRGTGTAIGVVDQRGQQGAVSGTSFATPIVAGVAALVRARFPELSALEVIKRIQ      360
361      ATAHAPAEGWNPYIGYGAVDPIAALTNAVPGELPPKRPTPAKSRQLAVPAPPPPPNNTPR      420
421      NVALIGSGVIAGALVLGYLASFPIRRRFGVSGDDM                               455

>MER0041887 - family C44 non-peptidase homologues [C44.UNW] peptidase unit: 2-245 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCGIVGYVGYRDALGVVVDALRRMEYRGYDSAGVAILDGAGTLAVERKAGRLANLEAELA       60
61       ESGAGAFAGTTGMGHTRWATHGAPTDRNAHPHRDAGGKVAVVHNGIIENFAPLRRELEDA      120
121      GVELRSDTDTEVAVHLVARAYAEGPTAGDFTASALAVLRRLEGAFTLVFVHADHPDTIIA      180
181      ARRNTPLVVGVGKGEMFIASDVTAFIEHTREAVELGQDQAVVITADSYTVTDFAGRGDGV      240
241      RTRPYTIDWDIAAAEKGGHDYFMLKEIEEQPAAVADTLIGHFTTDEAGGRIVLDEQRLAD      300
301      QELREFDKVFVVACGSSYHAGLLAKYAIEHWTRLPVEVELASEFRYRDPVLDRSTLVVAI      360
361      SQSGETADTLEAVRHAKEQKARVLAICNTNGAQIPRESDAVLYTRTGPEIGVASTKAFLA      420
421      QVAANYLVGLALAQARGTKYPDEVAREFQELEAMPKLVSRVLETAPQVRAIARELAHVPT      480
481      VLFLGRHVGYPVALEGALKLKELAYMHAEGFAAGELKHGPIALIEDGLPVIVVMPSPKGR      540
541      AVLHSKLLSNIREIQARGARTIVIAEEGDDTVRPFADDLIEIPSAPTLFQPLLSTVPLQI      600
601      FAAEVAQTRGYDVDKPRNLAKSVTVE                                        626

>MER0041269 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 7-334 ( active site residue(s): 156,294,322  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRGRIGRGGFATAVLVGALAGAHVVRRLGQWVLHLDVPDAYVAEDFALFEADEPSTVTAT       60
61       DGVPLAVRAHGPENADVTMVFVHGFCNSMESFHFQRRDLPARWGPRVRLVFFDQRGHGRS      120
121      GTPSTDSCTVPQLGRDVAAVLAAAAPSGPVVLVGHSLGGMAVLAAAAQFPALFGSRVAAV      180
181      ALLSTSAAQVTSTGITQLLRNPVIDGFRLAVEAAPALVQAARTAGRHVITPLLHVTSFHG      240
241      PVSPALSRFTARMIDRTPVETIVKFLEAIRVHDESAALSTLAQLPVLVLGGTRDVVMPFR      300
301      NSEALARELPDSELVLLPGAAHMPHLQYPDLVNDALHRLMVRAGVFRRGRSRRDGRTGSA      360

>MER0041159 - At1g63660 ({Arabidopsis thaliana}) [C26.A07] peptidase unit: 1-230 ( active site residue(s): 84,170,172  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAETQRPVLVVDFGAQYAQLIARRVREASVYSEVVPHTATVEEIAAKKPLAVILSGGPAS       60
61       VYAEGAPQLDPRLFDLNLPVFGICYGFQAMAQALGGTVAHTGTREYGRTELNIDGGVLHG      120
121      GLPTIQPVWMSHGDAVTDAPEGFEVTGTTAGAPVAAFEDRARRLAGVQYHPEVLHSPHGQ      180
181      QVLSRFLHELAGIPASWTPSNIADVLVEQVRAQVGDGHAICGLSGGVDSAVAAALVQRAI      240
241      GDRLTCVFVDHGLLRAGEREQVQQDFVASTGAKLVTVDAVDKFLGELKGVTDPEEKRKII      300
301      GREFIRSFEDAVRQIVDEQGAAEGKQPEVEFLVQGTLYPDVVESGGGTGTANIKSHHNVG      360
361      GLPEDLEFELVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLAIRIIGEVTADRLA      420
421      TLRQADAIAREELTAAGLDRQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAM      480
481      TADWTRLPYEVLERISTRITNEVAEVNRVVLDVTSKPPGTIEWE                      524

>MER0041254 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-241 ( active site residue(s): 99,203,229  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNSTFAHLSSHGVRIAYRDSGPADGVPVLLVHGMGGDGHTWDRFARRLLRDGRRVIVPDL       60
61       RGHGRSSRAATYGFDEFGADLLRLCEHLGLDGVDLVGHSLGGYAVSCVAQERPALVRKLV      120
121      IEECPLPLRSGDEELSLTRRFPTVPELWHAASSLVRHPRAVWAFDRSMTRVALEQFRKPN      180
181      PQWWERLSEITAPTLVLRGGPGGMVDPEKLTVLTAAVADCTVTAFTCGHSIHRDRYREFE      240
241      AAVLPFLTA                                                         249

>MER0041272 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 6-412 ( active site residue(s): 194,357,387  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLRVMTGLPKVGGKRARRRFSRHDRVVRVTVSTDQSPCPSATGAELLPPPDGTLAIVPVG       60
61       DIRLESGAVIPDVHLGVQRWGELSPGLDNVVLVEHALTGDSHVVGPADDVHQLPGWWNGM      120
121      VGPGAPMDTDEWCVIATNVLGGCKGSTGPGSTAPDGKPWGSRFPAISIRDQVTAEAALFD      180
181      RIGIHRLAAVVGGSMGGMRVLEWMVGAPERVAAALVLAVGARATADQIGTQTTQIAAITA      240
241      DPDWQGGDYHDTGRAPTTGMGIARRIAHLTYRTEDELDHRFANHAQDGEDPFDGGRWAVQ      300
301      SYLEHQAEKLCRRFDPATYVLLTEAMNRHDVGRGRGGVAAALAATPVPCVVGGVDSDRLY      360
361      PLHTQQELADLLPGCARLEVVHSRDGHDGFLTETAAIGKLLVETMRLARAHR              412

>MER0041178 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 41-158 ( active site residue(s): 92,117,118  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTGRTVAMAIAPGALHPWDLYELGVVAAIFGTPQPDLADPWYTLRVCAVAPDQGEQSIGF       60
61       GAFLRPEHGLAELLAADTVIVPSVAAHCRTGERALPAELLDALVAAHRRGARLVALCDGV      120
121      FALAAAGILTGRRVTVHWEHAGLLARRHPDLVVDDSVLYLDDGDVLTSAGMTAALDLCLH      180
181      LVRRDLGATVANRLARRMVIPPHRSGGQAQYVDRAVPADPRDDLGPVLQWAAAHLDQPLT      240
241      VDLLAARANMSTRTFHRRLQRAGGVTPKQWLLNQRLAYARSLLESTDLTVEAVARMAGLG      300
301      TATNLRRHFTTALGVTPADYRRTFARREPGTPPRDGAVA                           339

>MER0041271 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-292 ( active site residue(s): 122,250,280  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLTMTSDTSPSPASPAARASAATGAKPARKKPVERPAAMAALHIGSGDPLLLLHGFLLSP       60
61       HCWEQTATLMAAHCEVFAPALAGHWGGPEAPGRTIDIAALADAVERQLDEMGWRTCHIAG      120
121      NSLGAWVGVELARRGRARTLTLIAPAGGWNVPSLTQFRVALKFLSLVPVTRLGARMADFA      180
181      ARNRVVRRLALFPVVKNPTAVARRDAVATVTAAVNCRAMVPLILGSLRAPALADLSDLAT      240
241      PVRLLLSEYDRVIPNRVYARRFLKELPDSADRILVNRVGHVPMLEAPDRIATLIAEHVYA      300
301      SRTRLRAV                                                          308

>MER0041226 - family S11 unassigned peptidases [S11.UPW] peptidase unit: 108-434 ( active site residue(s): 139,142,194  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTARLSVPLRRLTAALTVAAALGAAVAIPAAAAPTAPTPPTTTAPFTTPETDTCPQKNVP       60
61       PPAVDTSEVPAPGEPAPTPLPVPVPPIGGARMGECGVVVPDDAPPLPRDISATAWMVSDL      120
121      DTGEVLAAKDPHGRYRPASTIKVLLAIVALRTLDLDRVVTGTQADADVDGTRVGIGPGGR      180
181      YTNRQLMQALIMASGNDAAHAIAAQLGGDKATVARMNEVAKSLSAFDTRAATPSGLDGPG      240
241      MTTSAYDLSLLFREAMTIPLFAELIRTEQIDFPGYPKNPLIPDDTDHPGFPIGNDNQLLY      300
301      NYAGALGGKTGFTDDARQTFVAAAERDGRRLVVTLLKADVLPIRPWEQAARLLDYGFALP      360
361      AGASVGSLPGAATDATDTEPNVVLAAPPPDDDETATAAQPERRHAGARTLLIVGGLVAIA      420
421      VLLLGARRVSRPRR                                                    434

>MER0041165 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 266-357 ( active site residue(s): 290,335,347  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIDINVLVKPLLDLLSSFGSGVLPSGGPSDALVSASTALEQLHQQGRASINQMNSAWDGV       60
61       AADAATAKALRVQTSAATISDRGTEMATVVNQAAAQVETGQKDLNGIVQSFVNTATALGP      120
121      TLATPQGLTVLVGSAIEHLNQGLAVVGRVRSELDTQTAAITQLTPPPSTPPVASLPGALA      180
181      GGASSGLQGLMGMVSQAGSLATTMASTPLKQVSKAANTGTTPSSAAPSGQNPNSSTSTTA      240
241      TTDGVKITLPDGSVVEAPNEKAATAVQAAIGAVGTPYVWGGNDPGSGIDCSGLTKYAYGE      300
301      AGVELPRLAQEQHIGHPQVSPGDLMPGDLAVWDGHVAMVIGNGQLVEAGDPVSISSIRTE      360
361      NMGMEFYGFYRPTA                                                    374

>MER0042640 - subfamily M20D non-peptidase homologues [M20.UND] peptidase unit: 22-395 ( active site residue(s): 147 metal ligand(s): 112,114,148,172,361 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPPPPPVPPSRDGARADAGARVDAAARADAAIGAAGPRLIALSHAIHAEPELAFAEHRSV       60
61       AKTLEPLAERGFEITTGVAELPTAFRAVYGSGSLTVGLCAEYDALPEIGHACGHNIIAAA      120
121      SVGAGLGLAEVADALDLTVVVLGTPAEESGGGKVLMLERGVFDDIAMAMMVHPGPCDIAG      180
181      ARSLALADIAVRFHGREAHASAAPDQGRNAGDAVTVAQVALGLLRQHLKPGQQLHGIVSD      240
241      GGIAPNIVPGHAELLYYLRAADSASLDDLMRRASACFEAGALATGCTHEIRTLAPTYTEL      300
301      TPDPGLLRVYREQIADLGRVPIAADLEAARPLGSTDMGNVTNVVPGIHPVIGIDAGGAVT      360
361      HQPGFAAASVNASADRAVIDGARALARTAIAVARDEEHRGRLWQRLVRRQEDIR            414

>MER0042645 - subfamily M20D non-peptidase homologues [M20.UND] peptidase unit: 3-267 ( active site residue(s): 16 metal ligand(s): 17,239 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPELPVGVRLIFQPAEEVMPGGALDMVAAGALDGIERIFAVHCDPRLEVGRVGMRVGAIT       60
61       SAADTVELVLDSPGGHTSRPHLTSDLVYAIGTVITGLPGLLSRRIDPRTSTVMVWGAVSA      120
121      GKAPNAIPQTGMLTGTVRTGDHATWSLLEPMVHEIVDGLLAPTGVRYQLNYRRGVPPVVN      180
181      DEHSARQFEDAIRALGPDALSDTPQSGGGEDFSWYLEEVPGAMARLGVWSGHGEQLDLHQ      240
241      PTFDIDERALAVGVRVFTNLVLQQRPR                                       267

>MER0041289 - family S51 non-peptidase homologues [S51.UNW] peptidase unit: 52-212 ( active site residue(s): 122,167,204  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRLFLASYRFGRHAQRLARLVGGPGRVAVVPNACDAWPSAWQAAVTSDLVPLRRAGYAPE       60
61       VVDLRDHLGQPAALERRLREFPLLWVRGGNTFVLRAQFARSGADRVIPALLAEDRLAYAG      120
121      YSAGACVLTPDLHGLDVVDDPQEVVTACGVAPRWDGLGLVPYRIVPHLDSPTDPDGACRR      180
181      IAEKYRTAGVPHHALTDDEVLVVDGDEFERLG                                  212

>MER0042507 - pantetheinyl hydrolase ThnT precursor [P01.101] peptidase unit: 246-352 ( active site residue(s): 246  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTAVPGPRDALTDVAGLLVGHHHVLDADASLGAGAATGCTVVRAPGGVTAAVDVRGGGPG       60
61       TRETDLLDPANTVRQVHALLLTGGSAYGLAAADGVMRWLEEHGEGIPMDPAEPARVVPIV      120
121      PGAVIFDLPVGAWDIRPTAEFGRLAAQAAGTEFARGSVGAGTGARAGSIKGGVGTASVVL      180
181      GDGPAAGVTVAALVVANPVGSVFDPRTGLPWGVGTDGPERFGLRPPTPEQLAAANALPVK      240
241      GTVLNTTIGVVATDAALDPAGCRRMATTAHDGLARAIRPAHSPLDGDTLFGVATGAVQPP      300
301      GFPLPSAFPAELLVLDAVCTAAAVCVERAVVDAVLTATTVAGVPAYRDLFPS              352

>MER0041291 - rhomboid peptidase 2 ({Mycobacterium} sp.) [S54.029] peptidase unit: 42-230 ( active site residue(s): 147,199  ) (Nocardia farcinica) (Source: MEROPS) 
1        MGASFDPERIAALRARADGATTTTPSRPGRFAGVRQLWARAAVLIAGFVALLYGIEGVDS       60
61       LDGKAQLDDAGIHPRELDGLWGILWAPVLHHGWDHLLANTLPVLVLGFLVLIAGILRGLA      120
121      ATAIIWVVAGLGTWLTGGSGTVHLGASALVFGWLTFLILRGWFARNLGQIVLGLVVLACY      180
181      GSLLWGVLPGPDRISWQGHLFGAVGGVVAARTLAGRRRGAQAGPPAAARV                230

>MER0041240 - family S14 unassigned peptidases [S14.UPW] peptidase unit: 1-188 ( active site residue(s): 92,117,166  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAHDDKTPLFGWRAREQLLSRRILVLDGPLDDDNGTLLATQLLTLAAENDEAPISLWIHS       60
61       PGGSVPAMLAIRDVMRLVPCEVSTLALGLACSAGQFLLSAGSRGKRFALPHARVLMHQGS      120
121      AGIGGTAVDVEVQADDLRHTVETVLGLIAADTGQPYDRIYEDSLHDRWFTAAQAKEYGFI      180
181      DHIVDSFGQVVPQRPRVGITL                                             201

>MER0041242 - ClpP2 peptidase ({Streptomyces}-type) [S14.009] peptidase unit: 1-197 ( active site residue(s): 101,126,175  ) (Nocardia farcinica) (Source: UniProt Q5Z0M4) 
1        MSTYTIPNVIAQHPRGGERITDIYSHLLAERIVYLGTPIDSGVANALIAQLLHLESESPD       60
61       QEINFYINCEGGDLPSMLAVYDTMQHIGAPVHTTCVGQAIAVGAVLLAGGAPGQRAMLPH      120
121      ARVVLHQPAARGQGPIPDLILQADELVRMRSEIEAILSRHTGRSPEQLREDTDRDRVFTA      180
181      TAALEYGLIDTVLSPRG                                                 197

>MER0042781 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 26-371 (Nocardia farcinica) (Source: MEROPS) 
1        MPTTALTGIGQLVTNDPALGEGPLGLRRDAAIVFEDGVVAWVGDSAHVPATDTAHDLDGR       60
61       AVLPGFVESHSHLVFAGDRAEEFAARMSGRPYGAGGIRTTIEATRAATDEQLGANVRRLL      120
121      DESLRAGSTTVECKSGYGQSVEHELRSVRVAGRYTDEVTLLAAHVPPPEYAGRVDDYVAM      180
181      ACAEMIPRCAPHAKWIDVFCEQGAFDRDQAHAVLTAGIAHGLVPRVHGNQLHRGPGVQLA      240
241      VEVGAASVDHVTYIDDADIEALAHSDTVATLLPGADFCTRNSYPDARALLDAGVTVALGA      300
301      DCNPGTSYTTSLPFCIALAVRELRMTPDEAVWAATAGGARALRRGDVGVLTPGARADALA      360
361      LDAPSHLHLAYRPGVPLISRVWREGTLAYATN                                  392

>MER0041220 - hormone-sensitive lipase [S09.993] peptidase unit: 99-348 ( active site residue(s): 203,297,327  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTVTAQAPAPAQAPAALSVAERLQRAAFTALGSIPGGLLRRIAPRVVNADGDVLAPEIAL       60
61       LLKATASAPDFSDGTPEQARAIVANDSRVFADKAPAGVRVEPEIVLPTGLRATMYRPAVP      120
121      SNALVLFLHGGGFVLSSRQDYDVPVRLIADGAGVNVLSVEYGLAPESPFPGPVDDAVTAW      180
181      RFAVEHCAQWGIDPARIVLLGDSAGGNLCAVLANIVAGEQVRPFLQVLMYPVVDAVGNYA      240
241      SRKEFADNAALSAKQIDWLTDLYLPDRTYALDPRVSPILAEDLSGAPPTLITVAGFDPLR      300
301      DEALAYAARLEEAGIPVRVFRESGLVHGYVSMTRISPTARAALDRVTDAVRTALEES         357

>MER0463368 - subfamily C82A unassigned peptidases [C82.UPA] peptidase unit: 241-372 ( active site residue(s): 331,349  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MMSVGPRRRRVLRALSLPAVLLAVLALALTACTSSNGGGSAVAIDRNPITELIKPKLLSP       60
61       VKDGDKGVSPAAPMTFQVEDGRFTDVTLVNQQGKAVQGKLAADGRTWETTEVLGYGKTYR      120
121      LTAEAIGLGGVNSTTLSFTTSSPDNQTKPYLIPGEGEVVGIGQPVAIQFDENIPDRRAAQ      180
181      DVIKITTNPPVEGAFYWLNNREVRWRPEHFWAPGTRVDIEVNVYGKDLGNGLYGQENITS      240
241      HFIVGDAVIFTADDNTKQVVVEQNGQVIRTMPTSMGKDSTPTDNGIYIVADKHEKIIMDS      300
301      STYGVAVNSPDGYRTPVDFATRISYSGIFFHSAPWSVGAQGNSNTSHGCLNLSPANAQWV      360
361      YNFAKRGDITIIKNTVGGTLSGTDGLGDWNIPWSVWKAGNADIG                      404

>MER0041184 - aminopeptidase N (actinomycete-type) [M01.009] peptidase unit: 235-428 ( active site residue(s): 304,389 metal ligand(s): 303,307,326 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSAPNLTRDQAIERAATVRVENYRIELDLTDQSADVSGVRTFGSRTTVTFTATPGASTFI       60
61       DIVAARVRSAVLNGTALDVSGYDESTGITLPGLAERNELVVEADCEYSHTGEGLHRFVDP      120
121      ADGKVYLYSQFETADAKRMFACFDQPDLKATFDITATAPLDWEVVSNGAGGRTEVGEVAV      180
181      HTFATTPRMSTYLVAMIAGPYAKWTDTYRDEHGDIPLGLYCRASLAEHMDAERLFTETKQ      240
241      GFGFYHRNFGVPYAFGKYDQLFVPEFNAGAMENAGAVTFLEDYVFRSKVTRASYERRAET      300
301      VLHEMAHMWFGDLVTMKWWDDLWLNESFATFASVLCQAEATEYTSAWTTFANVEKSWAYR      360
361      QDQLPSTHPIAADIPDLAAVEVNFDGITYAKGASVLKQLVAYVGLEPFLAGLRAYFAEHA      420
421      YGNATFDDLLTALEKSSGRDLSTWGAQWLKTTGLNILRPEFDVDADGRFTSFAVVQEGAQ      480
481      PGAGERRVHRLAVGVYDDQDGKLVRTHRVELDLDAAERTEVPELQGVARGKLVLVNDDDL      540
541      TYCSVRLDPESLDVLVNRIADIAEPLPRTLAWSAAWEMTRQAEFRARDFVALVQRGVGAE      600
601      TEIGVVQRLLMQAHTALAGYADPAWAEGVGWTEFADRLLELAREAEPGSDHQLAFVNALT      660
661      GARLEARHTEVLTELLDGDPAAVGLAGLTVDTDLRWRLVTALAAAGEIDADGLETPVIDR      720
721      ELAADPTAAGKRQAAAAATARPQAEVKAAAWATVMEDDTVPNITARSIVGGFAPVGQSEL      780
781      LAPYVERYFADIPAVWERRSSEVAQTVVVGLYPAWAISAEAVAVADKFLAGDHPPALRRL      840
841      VSEGKAGVERALRARAFDAR                                              860

>MER0041239 - ClpP1 peptidase ({Streptomyces}-type) [S14.008] peptidase unit: 1-196 ( active site residue(s): 100,125,174  ) (Nocardia farcinica) (Source: UniProt Q5Z063) 
1        MTKNQAGVMTSATAGLNLSDSVYERLLRERIIFLGTQVDDDIANKLCAQILLLSAEDPTR       60
61       DISLYINSPGGSVTAGMAIYDTMQFAECDIRTVGMGLAASMGQFLLTAGTKGKRYALPHA      120
121      RIMMHQPSAGIGGSAADIAIMAEQFAHTKRELNELQALHTGKSVEQVTADADRDRWFTAQ      180
181      EALEYGFIDHVISHANQANGIGG                                           203

>MER0041241 - ClpP2 peptidase ({Streptomyces}-type) [S14.009] peptidase unit: 8-216 ( active site residue(s): 118,143,194  ) (Nocardia farcinica) (Source: UniProt Q5Z062) 
1        MALIDPRAGLSGIAPSSPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDAS       60
61       ANDIMAQLLVLESLDPDRDITMYINSPGGSFTSLMAIYDTMQYVRADVATVCLGQAASAA      120
121      AVLLAAGTPGKRACLPNARVLIHQPSLEGGIQGQVSDLEIQAAEIERMRRLMETTLARHT      180
181      GKDPDTIRKDTDRDKILTAEDAKEYGIIDTVFDYRKLSAQK                         221

>MER0041235 - alkaline D-peptidase [S12.003] peptidase unit: 15-359 ( active site residue(s): 76,79,176  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLVGLCVGSTLLLVGCSTVQRASALQRDLDAVTAAGVAGAVATVDDRTTSLVITSGVADR       60
61       STGAAMPEHGRVRIGSVTKTFTAAIVMQLVAEGKVALDAAVDTYLPGLLTGDGVDGRVIT      120
121      VRQLLHHRSGLPEFAGRPGADELIAAAENRTLAPVEAVSTALAHPAQFAPGTRYAYTNTN      180
181      YIVLGLLIERVTGRSYADELRDRIIAPLGLTDTYLPAPGEREIRGEHPHGYLDTPDGVID      240
241      VSRIEPSIPWAAGALVSTGRDLNIFWRALVDGRLVPAPQLAEMTTPQDGASEDEGRGYGL      300
301      GVGATELSCGVRYVGHSGGIPGYHTMSGATPDRAATITFTQAPRTPPDSKALLEHALCP       359

>MER0041257 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-288 ( active site residue(s): 104,236,264  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTHSSALGRQREIDLPGGRIRYYETGSGSPVVFVHGLLVNANLWRKVVPDIAAAGYRCLA       60
61       PDWPLGAHSIPVPEADLSPAGLADLIAAFLDRLDLTDVTLVANDTGGAITQVLLARQRAR      120
121      IARVVLASVDCYERFLPPPFKLLTPLARIPGSLRPATELLRIRALHPLPIALGWVVKRPV      180
181      PPEVVDTYLLPSRRSGAIRHDLRRFLAGARNSYTLEAARHFGEIDLPVLLVWAREDKLFP      240
241      VRLAERLAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQHAAT                  288

>MER0041232 - lact-2 g.p. ({Caenorhabditis elegans}) [S12.A11] peptidase unit: 9-383 ( active site residue(s): 68,71,157  ) (Nocardia farcinica) (Source: MEROPS) 
1        MGNVAGTCDPAFAAVREVFEASLAAGADLGAAVAVFVRGRPVVDLWGGTADRRTGRAWEA       60
61       DTPCVAFSSGKAVTAVAALAVMRRTGIEPETPVVDWWPEFGAHGKDAVTTEHLFTHSAGL      120
121      PVLERPITKAEAADPAAMAAELAGQAPLWEPGTRHGYHALTYGWLVGELVRRGTGRSVGE      180
181      FVRELVDGELWFGPPAEVIAKAARLEFPAAHEMTWEPGDSASADAVIGRLAAAYRDPDSL      240
241      LMRSSTNPRGSHNDPAVLAGGWPASGLVATARGLAGFYRDLLGGALIPESLLRDAVRERV      300
301      RGADEVLLLDSAFGLGMMLPSQTLPVPEAARAGAFGHPGAGGSLGLADPDHDLAFAFVPN      360
361      MRREALAGDRRAEDLLAAVYAAL                                           383

>MER0041273 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-301 ( active site residue(s): 125,249,270  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAGPDVRATRIHRLVRRAGVPDIAGVPGGREIELPGRGSTYVVDIPGPAGAPALILLHGT       60
61       ASTALLNWFPALEGLSERFRVILFDQRWHGRGIRSRTFRLDDCADDVVAVADALDVPRAV      120
121      CVGYSLGGAVALTTAHRHPDRVAGLALCATPYRFREKWREKAFHQAFGALADVIAPLSLR      180
181      RAEKLLHALAEVPEQQWAPGDFERWALAEFRSTSGWALTQVIAEVGRFDATPWLHTLDLP      240
241      TAVVITTRDRAIPVYRQLEMATMIPGATIHLARTGHTGCVFGADRFVPAVLAACDSVADR      300
301      L                                                                 301

>MER0041263 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 3-280 ( active site residue(s): 102,234,261  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSFLDNTVRETTVDGVRVAYVTAGRGEPLVLLHGWPEDHRAWSHQLAPLAAVRRVIAPD       60
61       LPGWGASDRDVRLSHDYDSEVDRLARLLDALGLDRIDLACHDYGGFLGLGFLHRYPHRVR      120
121      RFALLNSRAHGTFTWPYRLLFGAFTTLASHRATRRLLTVRAMYPLHRWGLRGYVRNGSFS      180
181      PGLLDDYLSMLRTPEGLRWYAHFWAGYRVRVRPELAAGLAAVDCPTTVIWGRRDPAIPLR      240
241      TARELASRIPGAHLVLLDADHFVMEQRPAEVTEALLAWLDRPVENTAAAN                290

>MER0041180 - family C56 unassigned peptidases [C56.UPW] peptidase unit: 94-161 ( active site residue(s): 113,139,140  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAEILFVMSGADHWTLADGTKHPTGFWAEEFVAPYEVFTAAGHTVTVATPGGVVPSVDRG       60
61       SLAPEVNGGPENAAKLAEAVRTAAPLQHPVPLAEVDPADYAAVFYPGGHGPMEDLPTDAD      120
121      SGRVLAQALSSGTPLGVVCHGPAALLATADADGNSPFAGYRLTAFSNAEEEQAGLAAKAP      180
181      WLLADRLRELGVEYREGEPWAPHIEVDRTLYTGQNPASSRPLAEEIVRALG               231

>MER0041160 - trp1 ({Schizosaccharomyces pombe}) [C26.A25] peptidase unit: 1-230 ( active site residue(s): 82,170,172  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRTLLIDNYDSFTYNLYQLISEVNGVEPTVVRNDETDPAALDLAAYDNIVVSPGPGRPDR       60
61       TRDVGLSAAVIDAASQPLLGVCLGHQGIVVAAGGRVDRAPVPRHGFLDRVGHDGRDLFAG      120
121      LPQDFTVVRYHSLCALEPLPPALEVTARTPDGVIMGVRHRQRPQWGVQFHPESVAGEFGA      180
181      ALLRNFAELTLAHGKPARRTRPATPVTPARPAATDRPRWRLRHEVIERAVDTEAAFLRLY      240
241      GASPTAFWLDSEHVEPGLDRFSFLGDASGPLAEVVRYRVGADVVRVEDAAGTRTVAGDVL      300
301      GYLSTQLRERHVELPALPFDFVGGYVGYLGYEVKADCGARAAHRAATPDAQWIFADRLIV      360
361      VDHVAGQTHLVALTDDDTAADQWLRETGRVLETLPAWANPAELAIESAPASVAPLLNRGR      420
421      DRYLADIAACLEYLRAGESYEICLTDSLTVDAAIGGLDFYRTLRRCNPAPYAAYLRFDDL      480
481      EIACSSPERFLKIDRARTVESKPIKGTAPRGATPAEDERLRRELADSPKTRAENLMIVDL      540
541      LRNDLGRVCQIGSVHVPELMATESYSTVHQLVSTVRGTLRPDVDAIDCVRACFPGGSMTG      600
601      APKLRTMEIIDELEGAPRGVYSGTIGFLGLGGTADLNIVIRTAVRHDGRWRIGAGGAIVL      660
661      DSDPAEEYREMLWKAAATQRAATAAAATSR                                    690

>MER0041237 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 32-143 ( active site residue(s): 39,42,98  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRALEQIQDWPVRHAAAGVVSAAGSSVQGAAERVFPLASVTKPLVAYAALVAVEEGAIEL       60
61       DQPAGPPGATVRHLLAHASGIAFDTTDVIAAPGTRRIYSSAGFDVLADFITEQTGIPFPD      120
121      YLRESVFEPLGMTATALTGPAGHGARSSVDDLVCFAAELLRPRLISPQTHAEAVTVQFPG      180
181      LNGVLPGYGSQRPNDWGLGFEIRARKSPHWTGTTNSERTFGHFGQSGTFLWIDPEYGLAC      240
241      CALADENFGDWAREVWPVLSDAVIAESNTLTR                                  272

>MER0041275 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-256 ( active site residue(s): 100,216,244  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVKLARRLTRPGAEIAFADFGGDGSSVVLIHGAGVDHSMFDEQVPVLTQRGYRVIVWDLR       60
61       GHGQSALSPGERFTASDALEDLDALLAECGVDAPVLVGHSLGGNLAQAFARKFPQRVGGV      120
121      IVLDSTWNAGPLSALERFALRLAAPGLAVIPAGRLPRIMARASATTPEAMARTEALFTRI      180
181      PKRTFLDVWRATASFVAPEPGYRSPVPLALVRGAEDRTGNIATAMPRWADAEGLVEHVIP      240
241      GAGHMVTMDAPAETSRLLVSILDGWDQRPAASERRSR                             277

>MER0041223 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 1-290 ( active site residue(s): 112,242,269  ) (Nocardia farcinica) (Source: MEROPS) 
1        MERLEVSFVSGGQQCAAWLYPPAGVPKPRPLVVMGHGLGGTRDMGLDRYARRFAAAGMGV       60
61       LVFDYRHFGASEGDPRQLLHIGRQREDWRAAIAFARTLRGIDKTRIALWGTSFGAGHVLT      120
121      VAPEDDYIAAVVAQVPFTSGWASAWAKGPTSLTKVATIAATDLVIGSLRRKPVRIRLAGR      180
181      KRAAALMSAPDVPEGYGRLAEESATYEPKVAARVAFSALFDAPGKHAKELKMPVFYAIAD      240
241      NDSVAPVEPALKAAERTKHAVVKRYPVGHFDVYFDDVFEQAVYDQTEFLVSVLRP           295

>MER0041250 - prolyl aminopeptidase [S33.001] peptidase unit: 6-322 ( active site residue(s): 116,272,300  ) (Nocardia farcinica) (Source: MEROPS) 
1        MMRRELYPPIEPFDSGMLDVGDGQRVYWEVSGNPEGKPVVFLHGGPGGGTAPLHRRFFDP       60
61       ACYRIVLFDQRGCGRSTPHIADGADLSVNTTWHLVADIEALREHLGVERWQVFGGSWGST      120
121      LALAYAQRHPERVTEMVLRGVFLLRRKEIDWYYNGAAGYVYPDEWEKFLAPVPAGERDGD      180
181      LVAAYHRLLHSPDPAVVERAAVAWSVWEGSTSSLLPHPDRVAETAEPRFAIAFARIENHY      240
241      FRHGGFLAEGQLLRDIDRIAHLPVEIVQGRHDIVCPAVSAWELHRAWPGSRLHIVDDAGH      300
301      AANEPGIVHHLVEATDRFAKEG                                            322

>MER0041251 - Hip1 peptidase ({Mycobacterium tuberculosis}) [S33.023] peptidase unit: 97-555 ( active site residue(s): 269,497,524  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDFLLHPCASAVGDGHVGVGTGFAVRGTRGQRLIAGPAGGNWQDRGMGLRRGCGVLVAAL       60
61       AVVAAGCTIERGEQAGPMPAAPAGLERFYEQAVPWGPCAGFTDDQVRLPPNAQCARIEVP      120
121      VDYADPAGPTAQIALSRIPASGAKIGSLLLNPGGPGVSGLDTVAIANQTPLSERFDRVGF      180
181      DPRGVGASTPAITCLTPPEADAERAERPEDNTPAGIAAAEADNRDYAAKCVQRSGAELLE      240
241      HVGTREVVQDMDVIRAVLGDPKLTYLGYSYGTKLGSLYAEKFPDRVRALVLDGAVDSSQD      300
301      PVQESLRQAAGFQRAFDAYAADCARTPDCPLGTDPAQAVARFRELVDPLWERPAATTDPR      360
361      GLSYNDAITGVTQTLYTDDLWQVLTLGLQELRDGRGDTLLQLADLYDGRRDDGTYRNTQD      420
421      AFNAIRCVDDPRVTDPAVAARQDTEYRKAAPFLDDGRGTGAAPLELCAAWPVPNSGEPHS      480
481      ISVQGLPTTVVVSTTEDPATPYQAGVDLAAQLGAALVTFRGNRHTAALVAGNECLDSAVI      540
541      AYLVDLTIPPAGLTC                                                   555

>MER0041288 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-265 ( active site residue(s): 108,223,253  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSQTKDGSFEGTGSRIAWRAWLPDGPARAAIVLVHGVAEHSGRYVHVGTRLADAGYAVYA       60
61       LDHVGHGKSAGGKANIGSLDGAADNVAGMLDIAAREHPGVPRFLLGHSMGALIVLYLATR      120
121      APIDVAGVVVSAPPLEIPVGNPLQKLLAPVLTRLTPNLGVLQLDSSSISRDPAVVAAYDA      180
181      DPLVYRGKLPARTATEILDGSLTVKRRLGKLTVPTLVLHGTADTLAAPSSADLIERGAAA      240
241      EDLTVHRYDGLYHEVFNEPEKETVFADLERWLQDHLTTQ                           279

>MER0041195 - carboxypeptidase PM20D1 [M20.011] peptidase unit: 3-431 ( active site residue(s): 81,144 metal ligand(s): 79,110,145,171,414 ) (Nocardia farcinica) (Source: MEROPS) 
1        MDDATAERLAAALRCATVSGTGERADDSADGEFVRLAAHLEACFPRVHAELELERFGHSR       60
61       LYRWPGVEPERVSAILLAHQDVVPAGDGWTHPPFAGVVDDGFIWGRGAIDDKSRVLAILE      120
121      AVEAALAAGVRPRHTVYLAFGHDEEVFGDAGAVLMARRLRDAGVRAELLLDEGGVITEGV      180
181      ADGVSTPVASIMVGEKGYATVRLSVRETGGHSSMPGRQTAVGRIARAVARVQDRPLPLRL      240
241      TPVIADMLARLRTVMPPARRVLLGAAGVAGPVITRVMAARPQTEALVRTTTAPTVIRGGV      300
301      KANVLPQHAEALVNFRILPGDSVDGVLAHCRRVIRDRGVTVELVGMASEPSRTERPGPAF      360
361      DLVARLARQVVPGVAVTSGLVPGATDSRHYDGLAATRCNFAPIVLSEADLATIHGTDERI      420
421      SRVNYARLIEFNRRLIGELAAGPIGEEQR                                     449

>MER0041190 - family M17 unassigned peptidases [M17.UPW] peptidase unit: 23-503 ( active site residue(s): 280,354 metal ligand(s): 268,273,291,350,352 ) (Nocardia farcinica) (Source: UniProt Q5YZ53) 
1        MTAVADRSLGPELARTETLGPDTDVLVIGLTSSENGPSIAPDDMFGDVLTEDVRAELLDQ       60
61       LGAVGAKGKAEELTRVPAPAALEGVTSVLAVGLGAPDKLDAEQLRRSAGVAARSLTGTEV      120
121      VATTLGGIDIAAAAEGFYLGAYTFTPFRSAKSAPKPDERPVAKVEFLVPTADFGEEALFR      180
181      AQLVAEAVATARDFVNTPPSHLYPAEFAARTQVLAEAAGLDVEVLDENALEAGGYGGVLG      240
241      VGKGSSRPPRLVRLTYAGGPKKVALIGKGVTFDTGGISIKPAQNMENMTSDMAGAAAVIA      300
301      TTLLAARLSLPITVTATVPMAENMPSATAQRPGDVLTQYGGTTVEVLNTDAEGRLILADA      360
361      IVRAGEDSPEFLIDVATLTGAQMVALGTRTPGVMGTDEFRDRVARISQEVGENGWPMPLP      420
421      AELRADLNSKIADLANVAPHRWGGMLSAGLFLREFVPEGVQWAHLDVAGPAYNTGGPFGY      480
481      IGKGGTGVPVRTLIAVLEDIAAE                                           503

>MER0041172 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 36-151 ( active site residue(s): 84,110,111  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLSKVAVPLFEKLAMFEFGVVCEVFGLDRTADGLPGFDFKVCGAEPGKPLRSTTPGVTVT       60
61       PEYDLAELARADLVAVPAAPVSALTGDLDPQLVEAVRAAADAGATVLTVCSGAFVAGAAG      120
121      LLDGRKCTTHWRYVDQLAARYPKATVDPDVLFVDEGDLITSAGTAAGIDACLHLVRREIG      180
181      SAAANGIARRMVVPPQRDGGQRQFIERPVADCEADSLGETLLWMSEHLELPHTVESLAAR      240
241      ASMSTRTFARRFAAETGTTPVKWLTNQRVLRAEHLLEETDLGLEQIAARCGFGSGALLRH      300
301      HFQRQVGIAPTEYRRRFGRRPS                                            322

>MER0041924 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 2-270 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCGLLGFLTADAATSEVVDQVYNALHCMRHRGPDERGTWHDDHLVFGFNRLSIIDIEHSH       60
61       QPLRWGPPENPERYALTFNGEIYNYLELREELAAAHAAEFGDAPMFRTEGDSEAIVAAYH      120
121      YWGAEAVAKLRGMFGFAIWDTQTRELFLARDPFGIKPLFLATGPGGTAFGSEKKSLLDLL      180
181      PALRLSDDLDPRALEHYTVLQYVPEPETLHKGIRRLESGTYAVVRPGAAPQVTRYFTPRF      240
241      PVRPFAPGSAQTRYNEIAAALEDSVAKHMRADVTVGSFLSGGIDSTAVAALAMRHNPNLI      300
301      TFTTGFEREGYSEVDVAAESAAAIGARHIVKVVSPAEFAAAIPEIVWYLDDPVADPALVP      360
361      LYFVAKEARKHVKVVLSGEGADELFGGYTIYREPLSLKPFEYLPRGLRRLAGRLSERIPD      420
421      GTRGKSLLHRGSLTLEERYYGNARSFNDAQLRAVLREFRPEWTHQDVTAPIYAQSRGWDP      480
481      VARMQHLDLFTWLRGDILVKADKMTMANSLELRVPFLDTEVRRVAEQLPFDQKITKDTTK      540
541      YALRQALEGIVPAHVLHRAKLGFPVPLRHWLRGTELYDWAHTQIAESQTDHLLDKAAITA      600
601      MLVEHRAGRADHSRRLWTLLVFMVWHGIFVEDRIKPDIQEPVYPVTL                   647

>MER0041163 - YddH peptidase [C40.007] peptidase unit: 246-354 ( active site residue(s): 270,318,330  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVADHRPHRTRRLLGGILVAGVLATGVCASGPAIADPVALPATASEAVQRMIELSRQSEQ       60
61       LNQQALGAQADLDAKLAAQQAAEAELATRTAAVEAARAEVRRFQPVIDRTAIAAYQGART      120
121      NRMFAVLVSDSPQQLLDQMSTLDVLSAQTSEELRRFKKADDAAVAAESAARAAADTARAA      180
181      AAEAERVRADLERKRSELGGAIAQVVQAWGALSTRDKSALAGSPFPPGFDRDTLLQGLVP      240
241      GSGTSALAAGLTRVGDPYVWGATGPHQFDCSGLVQWAFKQVGKDVPRTSSAQASYGTPVA      300
301      KEDLQPGDVVFFYPDISHVGIYAGNGLMLHASTFGVPVAVAPMDSTPYHSARRY            354

>MER0041168 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 83-190 ( active site residue(s): 107,154,166  ) (Nocardia farcinica) (Source: MEROPS) 
1        MANNTVKRQAQRVVAAGAVGAATIGAFLLPAAPASAQPVTIPGVGTFEVPNEIPIPAEIP       60
61       GIQLGQPGPPPFVAPQKTVGELALDAALSKIGSPYVYGAAGPNAFDCSGLVQWSYRQAGL      120
121      ELPRTSGAQLSAGSPVSLDDLRPGDLVSFYGGGHSGLYAGDGNVVHAATSGSPVHIASIS      180
181      SMPVAGARRF                                                        190

>MER0041164 - YddH peptidase [C40.007] peptidase unit: 43-151 ( active site residue(s): 67,115,127  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPVSRIDGSTGGCVRMTRRIEYRKPLRRIAFGFVIATVASVLLAGAGWADTGSASGSAGS       60
61       SGSGSGSGSGSGSGSGSSSGSAALPVPSIAGLGALAAATTQVGKPYEWGGVGPHTWDCSG      120
121      LVQWAFRQVGVHLPRTTWQQAEVGAAVPLHALSPGDVVILHADASHVGIYAGFGQVLNAY      180
181      GVGVPVGLTPLNQFVIHTIRRF                                            202

>MER0041157 - signal peptidase II [A08.001] peptidase unit: 25-183 ( active site residue(s): 133,162  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPHTPGTEARHGPRSAREMMIGVNDDQRPPLRLRTLLIIAFCLYALDLLTKCLAVALIDP       60
61       GEPVPVIGDFARLALVRNPGAAFSMATGMTWLLTLIATAVVIGVIRIGRTLRSLWWAIGL      120
121      GMVLGGALGNLTDRLFRSPGPLQGHVVDFVAVGDFPVFNVADSAIVCGATLLVVATVFGF      180
181      EPDGTRVGRDDENDDAANEDGTDTDTAGEDGTAPEPDRPSPPPTDSERKGSESKGEENAA      240

>MER0041229 - lact-2 g.p. ({Caenorhabditis elegans}) [S12.A11] peptidase unit: 12-389 ( active site residue(s): 68,71,157  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSNDASVHGSAPPEFGQLVRVFGRTFGRRPGAGAALAVHLHGEPLVDIWTGEAGTEAWTR       60
61       EHGTLIFSATKGVAATAMHRLADRGLLDYNAPVAEYWPEFAANGKSRITVRQVMTHSAGL      120
121      SALSPLVEGFADVLDHELMEERLAAAKPDRLLGVPTYHALTYGWLLAGLARRITGKSMSE      180
181      LLRTEVSEPLGIDGPHLGHPPAEATTRYAPLAGNQLGLLGTPLGNAVMGRGHLLPGPLGA      240
241      AVRCLFLPGVHTILEGEHPPILRTELAAGNGVATASALARVYDVLACGGVVDGKRYLSAA      300
301      TMREIAKVRTYRLDHALFYLPMMWHLGYHSLPMPGARSGLGHIGLGGSFGWADPRLGLSV      360
361      GFVHNRLSAGQLGPDQLIAVWLLPLILTGLRGVRRGTAPQLRRAA                     405

>MER0042558 - family T5 unassigned peptidases [T05.UPW] peptidase unit: 201-405 ( active site residue(s): 201  ) (Nocardia farcinica) (Source: UniProt Q5YYF8) 
1        MTTTDSGTGKLVRTQGVTAPLGFRAAGIAAGIKASGKPDLALVFNEGPEYAAAGVFTRNK       60
61       VKAAPVLWSQQVLTSRRLRAVILNSGGANACTGPEGFQDTHRTAEELARALSNWGTETGA      120
121      GEIAVCSTGLIGDRLPMDKLIPAVTEIVHEMGGGLSGGTDAAHAIMTTDTVPKEAAFHHR      180
181      DKWNVGGMAKGAGMLAPSLATMLVVLTTDAAVTAEQLDTALRKATRLTFDRLDVDGSCST      240
241      NDTVLLLANGASEVTPSQEELEAAVFAVCDDLAAQLMADAEGVTKRVRVTVTGAANEDEA      300
301      VTAARAIARDSLVKTALFGSDPNWGRVLAAVGIAPITLDPDRISVSFNGNPVCVNGVGAP      360
361      GARQVDLSGADIDVLVELNVGDGEAMIRTTDLSHGYVEENSAYSS                     405

>MER0041236 - lact-2 g.p. ({Caenorhabditis elegans}) [S12.A11] peptidase unit: 28-403 ( active site residue(s): 85,88,176  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTADSTPSADTAHTDSTSHADHAAQRVDRRFVRLVAEFDRLFRRPGDGGGALTVYLHGEP       60
61       VVDVWAGFARPGVPWARDTVAVAYSTGKGVASTLLHRLAERGLLDYDHPVAEYWPEFAAA      120
121      GKQDITVRRLLTHRAGLHRLRGLLPGPVERFFDDEAVTAALAAATPDPRHTTTSGYHGIS      180
181      FGHLVAELVRRVSGGSFTEALRTELAEPLGIEDLWFRVPPQQRHRIATNFPTLTVAGMSW      240
241      ESSARLMGRTRLSAAADTTPRGFAEIMSDPRLHDSVMPGVNGVFSARALARLYAALALGG      300
301      TLDGVQLLRPETVAQIRTRQVFTPDYVLAFRIPWALGYHGVPMKPSRAEPISAFGHFGLG      360
361      GSGAFADPETGMSLAFVTNRLGGKLTPLGDARLARLGALAHNIAKRSG                  408

>MER0041995 - peptidyl-dipeptidase Dcp [M03.005] peptidase unit: 2-676 ( active site residue(s): 466 metal ligand(s): 465,469,494 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNPFFERSALPYELPPFARIREEHFLPAFERGMREQLAEVAAIAGDAQAPTFANTVVALE       60
61       RSGAVLRRVRAVFFALVSADSTPGIQAIEAEVSPRLAAHHDAIHLNAELFARIDALYERR      120
121      AELGLDAQDLRLLEQYHLEFVRAGARLDAAGQARLRELNAELAAAATRFGQNLLAATNAA      180
181      TVLVEHERELAGLAPDAVAAAAEQARALGHEGWALRLQNVSNQPVLAELSDRELRRRVLD      240
241      ASLERGFGTDPDNAATAVRIAALRAERAALLGFPDHAGYVVADQTASTAEAVEEMFARLV      300
301      PPAVANAEREAAELAAAMRAAGAGDELRAWDWLYWSERVRAERFAVDGAALRPYLELERV      360
361      LWDGVFHAAERVYGITVRERADLTGYHPDVRVFEVFDADGSPLGLFLGDYFARPSKRGGA      420
421      WMTALVDQSTLLGTRPVVTNVLNIARPPEGEPVLLTWDNVRTLFHEFGHALHGLCSDVRY      480
481      PYFSGTAVPRDFVEFPSQVNEMWMDHPEILARYARHVETGAPMPPELVERLREAARFGEG      540
541      FRTVEYLAAAQLDWAWHRVADPAALDGVDAAAFEEQALRKAGLALSAVPPRYRTAYFAHI      600
601      FSGGYAAGYYSYIWSEVLDADTVEWFTDGAAPIRDKGEIFRRTLLARGGSVDPMAAFAQV      660
661      RGREPDIGPLLARRGLSRT                                               679

>MER0041207 - subfamily S8A unassigned peptidases [S08.UPA] peptidase unit: 76-399 ( active site residue(s): 115,147,268,339  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSEPTHVLAGEKLVVLRAPARAVLREPNAGPAAFPAEVAADVRIDIDEVDAATLRSVAAD       60
61       PTVVGFGPAMPMRLVEPAERGGVVAAAAGPTWGVEAVGATTSPFTGQGVTVAVLDTGIDA      120
121      DHPAFAGVDLVTRDFTGGGSAHDKDGHGTHCAGTIFGRDLDGTRIGVARGVGRALIGKVL      180
181      GPGGGGSDTIAEAILWARDNGAHVISMSLGIDFPGFVEKLVTLRGLSIPVATSLALRAYT      240
241      ANVQLFETLSQFLAAGIGQPMVVAATGNESGRDRTPPFEIDVAPPAAAAGIVAVGALGRT      300
301      ANGLAVAPFSNARATVSAPGVGVVSAAVGGGTESMSGTSMATPHAAGVAALWAEKLAAQG      360
361      QLAPLVLQAKLIGEATTDRLIPGTDPTDTGAGLVRAPQS                           399

>MER0038302 - family S1 unassigned peptidases [S01.UPW] peptidase unit: 108-257 ( active site residue(s): 127,173,252  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPSEEHTMTVIDPAPGHLLERTEIPTTVKELVHAIPGQEQHALNPAEAPARGDAVTAPYC       60
61       PPWATYAEPTVAETFSLDGQTFYEPLVHEEPNPMLYPMCTVGIVFNSNGKRGSGVLVGPN      120
121      LLLTAGHVAPWGASNWSMEFIPAFRNGDRPFGSSFVQSYWGYNPGGDVPTGYDYVICKLY      180
181      NPLGNALGWMGSQSWGDEDEYYNRRYVSSGYPGSYGQRPAVELDMGIRDIDNDSPGKELE      240
241      FALRADLGPGWSGGPLWVHTANPFVVGVCSGQEKDGLDPTRLVFAGGKGMVDVVRHGLTD      300
301      MRP                                                               303

>MER0467416 - subfamily M10B unassigned peptidases [M10.UPB] peptidase unit: 90-168 ( active site residue(s): 157 metal ligand(s): 156,160,166 ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MNTLAICSPKRLPDDKQIESARLAVEINPANMPYVRPIAGLVGERPVNREFISAMTTKYW       60
61       RSGGVHLGVRFLDTTDRALQDRILAHMNAWSPGANIGFHRSTAPDAEIRIARTPGDGYWS      120
121      YLGTDVLQIPADEPTMNLDSFGLDTDEREYTRVVRHETGHTLGFPHEHLRRDVVHRIDPA      180
181      KAIRYFRDRVGWSEATTRAQVLTPLEEVALITTPTDTQSIMCYQLPGSIMRDGRPVPGGL      240
241      DINDRDRGFVHVLYPTAVATTPIQALAGVH                                    270

>MER0041287 - SCO7095-type peptidase [S33.010] peptidase unit: 1-255 ( active site residue(s): 97,214,243  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVDVPYIENNGVKIHFTDTGGSGRAVVLGHGFFLDQEMFAAQAAGLAPDYRVIAIDARGF       60
61       GGTEDSGEPFSYWDLARDAWAVVDALGLDRVVAGGMSQGGFTALRMALLAPPRVDGLILI      120
121      GTSAEAYTPKQKIGYREVMDAWTGSGPLAPIAKTMASVMIGGTDEDRRPWLDKWSTGDRR      180
181      RIRLAADCLINRESITELIGEITCPALLLRGISDQAFAAEDMEALAASLGGPTRFHTIPG      240
241      ATHAVNITHPREVNALLREWLAQLDGTPSQS                                   271

>MER0042635 - family M20 unassigned peptidases [M20.UPW] peptidase unit: 13-408 ( active site residue(s): 81,124 metal ligand(s): 79,90,125,198,379 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTFDALWDSIRAIGRHPGTGGYRRFAWTDADLTLREWFTGCATQRGMDVEQDRNGNLWAW       60
61       WLPPGHTGEPRDAFVTGSHLDSVPDGGAYDGPLGVVSAFAAVDLLRERGTVPARPVAVTA      120
121      FSDEEGARFGVACVGSQLSTGALAPARALGLRDADGITLAEALTAAGREPRHLGPDPALT      180
181      ERVGVFVELHVEQGRALDLVDRPVAVASSIWPHGRWLFRFTGEANHAGATRLADRHDPML      240
241      AFAASVHSARQAAQLHDAVATFGKLRVLPNGANAIPSEVLAWLDARAADEITLDALVTHI      300
301      AEAARKHAEADGVTVDLETESLTPIVEFPAGPRARITRALSRLGEIPVLPTAAGHDAGIL      360
361      SARVPTAMLFVRNPTGISHSPAEYATPEDCRTGARALADVMGEWVAAG                  408

>MER0039099 - family C44 non-peptidase homologues [C44.UNW] peptidase unit: 77-299 ( active site residue(s): 77  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCGIVGLHLRDATLYPRLGALLTGMLDQLCDRGPDSAGMAVYGDPTWSPPGESTVSLLDA       60
61       GLPAADLAARLTAALGVPVTGLDLAPTTVLHAPLDAAALSAAVPDIAPHARVIGFGTDLT      120
121      VLKGVGHPTALAHRFGLPAAAGWQGVAHTRMATESAVTAAGSHPFSVGPDQCLVHNGSFS      180
181      NHRSVQHELRRAGVVFDSDNDTEVGARFIAAQLAQGVDLEKALTLLNERFDGFYTLLVAD      240
241      SESFAVVRDPIACKPAVVAETDRWVAMASEYRALADLPGVADAHIFEPEPEEVYLWHRQ       299

>MER0041212 - hormone-sensitive lipase [S09.993] peptidase unit: 54-309 ( active site residue(s): 165,258,288  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRDARRLIRDAGLATMIGMDPELEPFLPLFPPSDLSDIPQARRQLAELAAAVPADIAAHL       60
61       DIEDRTVPGEPAVPVRIYRPQHARGAIVWAHGGGFVMGDLDTEHPWATRLADGSGATVIS      120
121      VGYRLAPEHPFPAAHDDMYAVLTWAAAHADELGIDPARIAVGGHSSGAGIAASVALRARD      180
181      EQGPPICLQLLNQPGLDDRQRSWSARNFTDTPFLNRSKVTQMWEYYLQGTPATPYAAPAR      240
241      ATDLSGLPPAYIATAEYCPNRDEDIDYALRLLWAGVPVELHQWPGTFHGSQAIVSAAVSQ      300
301      RQNEEFAAALRRAVGEP                                                 317

>MER0041228 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 76-424 ( active site residue(s): 131,134,222  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPCNSSEEVRAVPGRRRVAVGLLALGLVVGACADDSGGDAATTSSAPRSPAATGELPPNE       60
61       VAGVAIPDGQVDRAVGELDRIAGELMDATKIPGMAVAVVHDGKVVYSKGFGVRDVTTGQP      120
121      VGPDTVFQLASLSKPIGATVVAREVAAGRVAWDTPVRRLSPEFTLADPYVGDHVTVGDLY      180
181      AHRSGLPDHAGDLLEDLGYDRAAILARLRQLPLAPFRDSYAYTNFGLTAAASAVAQAAGT      240
241      DWETLSQREIYEPLGMTSTSSRYADFVARGDRAVGHVLVDGAYRPADPPRRPDAQSPAGG      300
301      VSSSARDMTRWLTMMLGDGSVEGREIVPPAALLPAVSPQMMSAPPANPDARAGFYGFGFN      360
361      VGTSPAGRVVLSHSGAFNLGAGTAFTMIPSAGVGIVTLTNAAPRGVPETLNAEFADLVQF      420
421      GEVREDWRGLYTEAFDQLDAPKGDLVGKEPPRAPAPARPLTDYAGTYANAYYGPATVAVR      480
481      GDELTVTLGPAGTVVPLRHWDGDTFAFTPSGEGADPGTVSQARFDGDRLTLEYYDQDGMG      540
541      TFTRG                                                             545

>MER0041187 - Zmp1 peptidase ({Mycobacterium}-type) [M13.009] peptidase unit: 36-693 ( active site residue(s): 533,600 metal ligand(s): 532,536,596 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTENGAAPGRRACGLRWDRRRFLTVGAAVPLAVTLASCAGEDAAAPTGTAGPDLTGVDPA       60
61       VRPQDDLFRHVNGGWLRDYRLPPDKASHGTFEELADRTEDRLREILEAPDDAGPGTDARR      120
121      LRDLYRAYLDTAAIEAAGTRPLADLLGEIDAAATKSDLARVAGALHALEVTGPVWLRVEP      180
181      DRKDSTRHRPYLVQSGLGMPDEAYYREPVHSELRTAYRGYLTRIATAAGLPDPAGVAERV      240
241      FDLETQLAAGHVDMVRWVDSLSSYHPWSWTELRDRAPGFDWDAWLDGLGGQRARFETVLV      300
301      DQPEYPAALARLWEAEDAGRWREYLRLRLFDHYAPVLPAAFADAHFDWAERAQTGIQQPP      360
361      PRWRAAVRFVRTKMGDALGREYAQRHFPTESKRQVEQLVEDLLAAYRQRLAEADWMSEQT      420
421      RRTALAKVDKIVALIGYPDTWRDYSGLVVRPGELLASLRAVENHEFRHRLGRLDRPVDRR      480
481      EWTMLTPVEVNANYSWEINHIVFPAAILQPPFFDPAAAPAVNYGAIGVVIGHEIGHGFDT      540
541      GGSRYDENGTLRDWWTSADKAAFETKTKAVIAQYDPLVPAGMPPDRRVNGALTVTENLAD      600
601      IRGVSTALAAYRIAAARAGAAEPDWRALFLSYARIWRHTATPEYTAATLGLDSHAPAEFR      660
661      VNQVVRNMAEFHTAFEVRPGDGMYLAEHERVRL                                 693

>MER0041177 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 35-144 ( active site residue(s): 79,93,94  ) (Nocardia farcinica) (Source: MEROPS) 
1        MHVVAVLALDRVIPFDLSTPLEVFTRTRLPDGRPAYRVRVCAERPQVDAGTFTLRAPWGL       60
61       DGLDGADTVIVPGVADPASPPSPAVVAALRRAAAAGTRIASICTGTFPLAATGLLDGLRA      120
121      TTHWAAAEALARAHPAVTVDPDVLYVDNDGRVLTSAGAAAGLDLCLHLVRRDYGSAVAAD      180
181      AARLAVMPLEREGGQAQFIVAPLPPAPRGSALEPLLIWLQDNLSRPLTLAEIAAHAGTST      240
241      RTLLRQFRDQTGTTPLRWLHRARIHRAQHLLETTDHTVERIAAQVGFGSPTTFRERFTRV      300
301      TGVTPHAYRRSFR                                                     313

>MER0041218 - subfamily S9C unassigned peptidases [S09.UPC] peptidase unit: 41-290 ( active site residue(s): 145,239,269  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSGLGMRAVGLYLRLTSRRRMATAERARARMAAPKGSAAPPARLRARHTVTERRFGQFTT       60
61       YTVTPRHRAPHCAVLFLHGGSYIAEIARQHWGLIARLVDHGARVDVPIYGLAPRFTHHDA      120
121      YPFVTEAYRAMAAEAPGPLTVLGDSAGGGLALGFTQTLAGLDEPVRRPDRLVLIAPWLDL      180
181      TLSNPDMAAVDDPWLTRAGLLEAGRAWAAGTDPTDPRLSPLNGPMDALPPTDLYIGTRDL      240
241      GYPDACAFRDRATAAGVRVEFTVCGGALHDYPLLPTREGRAAAARIARAVCASR            294

>MER0041179 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 33-144 ( active site residue(s): 79,93,94  ) (Nocardia farcinica) (Source: MEROPS) 
1        MESTDRDDVVVALADGVLLLDVAGPVQVLHWARRRVRFASLDGGPVRTDVGAPLGADCAF       60
61       AEVAARIDTLLVPGFAPDDRPDSRLVAAVGALAGRARRVAAVCTGAFVLAEAGLLDGRRA      120
121      TTHWMGCGELARRFPRVAVQPDAIYVRDGGVVTSAGVTAGIDMALALVEEDQGQELARTV      180
181      AKQLVVFLRRPGGQSQFSVRAQIAGPRADGVRAVVDAVIADPAGDHSLPALAARAAMSER      240
241      HLSRLFRRELGTTPGRFVERARVEAAQHLLEASTDPIPVVARRCGLGSEETLRRTFVKVL      300
301      GVTPSDYRARFRAH                                                    314

>MER0041219 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 5-296 ( active site residue(s): 117,249,275  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSTRTEMAFDSHGTTCHAWYFHGGDSPFAGERGRPVVVMAHGFGGTKDSGLEPFARRLAA       60
61       AGLAVFAFDYRGFGSSEGQPRQRVSMRGQVEDYRAAIAAAGRAPGADPARIVLWGVSQSG      120
121      GHALTLAAERADVCAVIALVPMVSGLAAGRHAFAQRGAAPMAAATLAGLRSAVATRLGAA      180
181      PTMMPLVGRPGERAALTAPGYYESYRALAGPTWRNEVDAAVGLELGGYRADRHADRITAP      240
241      VLVQIADFDRAAPAHAAAKAAFAARAEVRHYPCDHFDVFAGNPWFDPVVDHQLRFLTRKL      300
301      GSAGQPAPATAEAAE                                                   315

>MER0041194 - glutamate carboxypeptidase [M20.001] peptidase unit: 1-377 ( active site residue(s): 88,144 metal ligand(s): 86,115,145,169,348 ) (Nocardia farcinica) (Source: MEROPS) 
1        MIRRVDGEHDTLVRAGEALPDMVARLADLVGCESPSDSPADLRRCADLLVSWLAPLLPHR       60
61       VEVLERDGLPHVLAAAAHPTVLLLGHFDTVWPLGTLTDWPFTVRDGIARGPGVFDMKAGI      120
121      VQLVTALALHGDPGRVSVLLTGDEEIGSRSAWTLIEEQARRAGAVLVCEPAADGGAVKVG      180
181      RKGIANYDIEIRGRAAHAGLEPERGINAGVELAHQILALTALADRDTTVTPTVLSAGTTG      240
241      NTVPERAHCHVDVRSWTTAAMADVDRALTGLRPHLPGAEVVVTGGIDRLPFEERAAAGLL      300
301      AHAEAAADELGLGPLATATAGGVSDGNISAAAGVPTLDGLGAIGGYPHARDEHVQVHTMP      360
361      RQTALLTELLARLAQRRPGRLER                                           383

>MER0042484 - family M56 unassigned peptidases [M56.UPW] peptidase unit: 136-268 ( active site residue(s): 183 metal ligand(s): 182,186,223 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNATAPVFAGLALLLAGPAPALLSRAKWPYRTPRAALVLWQAIALAAVLSAFGSGLAIAA       60
61       ELLVPGPDGRPTTSPTREIDALGFPLWLAYVVVFALTLLVGARLIFSIVRVGVHTRRRRA      120
121      KHRMLVDLLDQSGPRRRAHDIRVLAATEPIAYCLPGLRQRVVLSEGTLTNLADPEVTAIV      180
181      SHERSHLRARHDLVLEAFTAVHEAFPRVVRSKAALGSVKLLIELLADDSAVKVTGPAPLA      240
241      RALVACAKSTAPQGALAAGGPTTLIRVQRLGQGGSGDVRIATAAYLGSIAILVVPTLAVA      300
301      VPWLVELSRLFNS                                                     313

>MER0042299 - urease [M38.982] peptidase unit: 4-573 ( active site residue(s): 367 metal ligand(s): 141,143,224,279,327 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTELSRARYAELFGPTTGDRIRLADTDLLIEITEDRSGGPGLAGDEAVFGGGKVLRESMG       60
61       QSRATRADGAPDTVITGAVIVDHWGIVKADIGIRDGRICGIGKAGNPDTMSGVHPDLVVG      120
121      PSTEIIAGNGRILTAGAIDCHVHFICPQLMDEALGGGITTLIGGGTGPAEGSKATTVTPG      180
181      AWHLARMLEATDHWPLNIALLGKGNTVSEAAMWEQLRAGASGFKLHEDWGSTPAAIDACL      240
241      RVADASGVQVALHSDTLNEAGFVEDTLAAIAGRGIHAYHTEGAGGGHAPDIITVAAHPNV      300
301      LPSSTNPTRPHTVNTLDEHLDMLMVCHHLSPSIPEDLAFAESRIRPSTIAAEDLLHDLGA      360
361      ISMIGSDSQAMGRIGEVVMRTWQTAHVMKRRRGALPGDGAADNARVRRYIAKYTICPAVA      420
421      HGLDAEIGSVEVGKLADLVLWDPAFFGVRPHAVLKGGAIAWAAMGDANASIPTPQPVLPR      480
481      PMFGAAAPVAAATSLHFVSEHALADGLAERLAVRRKLVAVKDVRRLTKTDMPLNDAMPRI      540
541      EVDPDTFTVRVDGEVWAEQPATELPMAQRYFLF                                 573

>MER0213616 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 53-234 ( active site residue(s): 95,203,231  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MERAIAATDWLRELRTDPAPRHHLVCFPPGGGSATAYRDLARRTGPGIAVLGVQYPGRQD       60
61       RLGEPAVPDLHTLADRIAAELLPQPVDRLALFGHSMGATVAYETARRLTEAGLPLTHLFV      120
121      SGRPAPTFVEPGRLHQGPDEGLIADLERLATDPSSVAVLRTEPGLADLVLPAVRADYQAV      180
181      ETYTPGGTDPLPCPITALVSTADPTMTPEQGDEWRDFTTGAFRRETFPGGHFYLDEQVAE      240
241      VAALISSVLAES                                                      252

>MER0041260 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 11-286 ( active site residue(s): 109,238,267  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQITFVPDATLYPFASRWFDSSVGRVHYIDEGAGPTILFCHGAPAWSFLYRRIVRALRDR       60
61       FRCVAVDHLGFGLSERPTGFGYTVAEHTAVLGELIDHLRLEDFVVMGHDWGGPIGLGAAG      120
121      ARADRVRGVVLGNTALWPIDALANRVFSVVMSSRPLQRRILEHNFLIDRVLLAELRGVLT      180
181      KAEADHYRGVQPTPAARRGLAVMPGQIRAARPLLEELARKVPERLGDKPTLAVWGMRDVV      240
241      FRPSACLPRVRAMFGDLEVVELSGARHFVQEHEPDAIAVAITERFS                    286

>MER0042782 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 25-232 (Nocardia farcinica) (Source: MEROPS) 
1        MSTADLIVTGGPVHTMDPDRPRASAVAVTGGRITAVGAEEVLELRGASTEMIDLGGRCLL       60
61       PGFVEAHTHPTQDQMMYSDAVVDIRPVTTCPSAEDVHRTIERALAAAPADAPLIFYGLDI      120
121      LLQKGFPEPTRGWLDDLGPARPIVIWQNSGHLAYANSAALAQAGVHAATPDPVGGSFERG      180
181      ATGEPTGRVYEAPAVLAVVAPILAGELTGPGLLARQHAELARRGVTLCSDMAFSDRLRPL      240
241      TDELYRRDLAKVRMRVYEMSTADGRASCPLDNGDDMFRQIGIKLWLDGSPWIGNIDISFP      300
301      YLNTAATAALGLAHDHRGHANYTAAQLDSIMAAYHPHGWQMACHIHGDHGVDTILDVYER      360
361      ALATHPRPDHRLRLEHCGAMTAEQFRRAARLGVTCSLFIDHIYHWGDVLVDDLFGPDHGA      420
421      HWTRARSALDAGVRISFHNDSPVTEEEPLRNIAAAVTRTTRTGRVLAPQERITLDQALRA      480
481      QTLDAAYQLFADDITGSITPGKYADLVVLDRDPYDVDPAELPAIEVHATYLAGTPTFSG       539

>MER0038251 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 19-257 ( active site residue(s): 105,229,257  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTSSRISEPRAGELAVPGARLYYEVRGAGPLLVLAGAPMAAADFAAVAEQLAATHTVLT       60
61       TDPRGHRGSTLDHPAADSTPALRGDDLARLIEHLGAGPATVFGSSGGAVSALALVQRRPD      120
121      LVATVIAHEPPLIELLDDREALRAGTHAMIATYLSGDVVGAWRMFFAQANIPIPDEALEQ      180
181      MFGGARDPEQAATERYWFEHELLGTVTWQPDIAALTAQGAKVVVGVGADSAGQLCDRTSR      240
241      ALAARLGGEPVVFPGDHTGFVDDPAGFAAFLTDLAVRR                            278

>MER0180643 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 554-689 ( active site residue(s): 602,625,626  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MTGHTPDTPDNAADADHAAGGADRKQRQLDAHRVDREQGHLTTQQGVRVRHTDDALSAGA       60
61       RGPTLLDDFHAREKITHFDHERIPERVVHARGAGAYGYFQPYDDRLAEYTVAKFLTDPAE      120
121      RTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTSQGNYDLVGNNFPVFFIQDGIKFPDFV      180
181      HAVKPEPHNEIPQAASAHDTLWDFVSLQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFR      240
241      FLDAAGTPTFVKFHWTPKLGVHSLVWDECQQIAGRDPDYNRRDLWDCIEAGHYPEWELGV      300
301      QLIPVEKEFDFDFDLLDATKLVPEEQVPVLPVGRMVLDRNPDNFFAETEQVAFHTANLVP      360
361      GIDFTDDPLLQLRNFSYLDTQLIRLGGPNFAQIPINRPVADVRNHQQDGYGQHAIPRGQA      420
421      SYTVNSIGGGCPVVGGDGSYEHYPRQVDGRAQRRRAESFREYYRQPRMFWRSMSAPEAEH      480
481      IVEAFAFELGKVQRVEIRERTLGQLVRIDPDLAVRVAGRLGLPAPPPDPEAGTDAFVSPA      540
541      LSQAHTAKDSIATRQVAVLAADGVDAAGVRALRSALTERGAIVEVIASHGGMVHADGGDG      600
601      DTLPVDRTLMTVASVLYDGVVVAGGQTGVETLTRNGEAVHFVLEAFKHAKPVAAFGAGVS      660
661      LLRIAGILDAARAHDADPATGVITTEARGDGLDEEFVTDLARALANHRTWQRATSAIPA       719

>MER0041253 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-298 ( active site residue(s): 85,250,276  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDGQTFHLVHVRSANPAATPLLLNHGWPGSFVEYQRLVPLLTEEFHVVIPSPPGFGFSTP       60
61       LSGTGWELARTTDACAEIMTRLGYPRFGAHGTDMGSGITGRLAAVYPERVIGTHIGADHR      120
121      WLGLVGDEFPLPDSLSDDEIAQLAAVRTEAAADRGYLAMQNHRPDTIGAALTDSPVGQLA      180
181      WIAEQFKTRPVGDHRTPDQSVDRDQLLTNISLYWFTRSGASSAQFYYECKHSDLDLLMAS      240
241      GVPSGWAVFDTHPLIRRVLDPGQAIGQWSEFTEGGHFPAMEEPELLADDIRAFFRRIP        298

>MER0041277 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-258 ( active site residue(s): 80,205,234  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSPARSSVVLFHGVTMSAAAWDDVVPHLSDHHDVFAPTALGHRGGPAVRQRPVRVRDVVD       60
61       AAERMLDDRGIEQAHLAGNSLGGWIAIELALRGRASSVCALSPAGFWNPGGHGQTAAVRK      120
121      LRRLGALTRATHRVQPLVFRSATIRRLAMRDIACHADRLTPAQALTAATDLVECAATDDL      180
181      LATDEYIPAVPDLPCPITLAWSGADAILPPEVNGRIARERLPQARFEILPGVGHVPMIDD      240
241      PELVAATILATTGAVPGPHRA                                             261

>MER0041173 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 35-148 ( active site residue(s): 75,97,98  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIVAVLASEGAVGFEVMLPGVVFGAANTVCADDRYEIRIVTPEEGATTGAVHGRVRLQS       60
61       DWGIDTLAAADIVVVPGRDDYRTEPSAAVCQALRAALARGARVASVCVGAFTLAAAGLLD      120
121      GLRATTHWAHAAELARRYPQVEVDPSVLFIDNGPVLTSAGIAAGLDVCLHLVRQDLGAQV      180
181      AADTARRIVMPPQRDGGQAQFIAHADPADPDTSLQPVLDWMQANLHRPLTLDDIAAHGAM      240
241      SVRSLNRRFRAEIGTTPLQWLLRARVHRAQQLLETTGLSVDRVAEESGFGSATTLRYHFT      300
301      RLTRTSPQAYRTTFQHGDAGDRESALARSSR                                   331

>MER0041276 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-292 ( active site residue(s): 115,231,259  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIGKGGIMLRVEDQLVRHLKTSGGDIAYSAVGSGPPLLVGGWWCSHLTLNWEDPLFRAY       60
61       LTRLAERFTVIRYDQPGRGASGTGGNTLDLDGEIAVTTELIEALGLDRLALVGASSGAAV      120
121      AAGLAARMPGRVHRLVLYGAFARGADIAPEAARRAMVDAISAHWGLGSRLLADIFIPGAG      180
181      NAERERFAQFQRLSATAEQAARSLAGAYALDATDYLAALTVPTTVLHRRDDRAVPFALGV      240
241      DVARRVRRATFVELPGEDHFPWRGDAGGVADATLRGLGHPIRSHPTPPGPAALTEREREI      300
301      LRLVADGLTDAQIGERLTLSPHTVHRHIANARIKLGVRSRAAAAAAIRDR                350

>MER0041169 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 4-349 ( active site residue(s): 4  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSRWCAFLTEDDPAAHVRAVGAEPITAGPITAGSITAAGPHGFGLLDGPGVAAGPFTAGA       60
61       LTAVGEVTLFNADRLRARLGADAPPPGRPDGEVLLHSYARFGLDGIAAAEGMFALAVADG      120
121      PDLVLLRDQLGARTLFHARARAGWAASTSLRALRRWPALRTGLHLPAVRSFLTFAYLPGR      180
181      ETLLRDVHEVLPGRCLRLHPDGTSTEHTYWEPREHIDERPASEHALRLRALLEDAVTRRL      240
241      PAGEPVGVLLSGGIDSSLVTALAAKLHDQAVHTYSISFGADAPDELGYSGLVATHCHTRH      300
301      RVLTVPGQTVAARLADTVGLLDSPVGDPLTVPNLMLAEAVAADGIRVALNGEGGDPVFGG      360
361      PKNLPMLIFELTRDDPAEDARAHAYLDSYRKCYADLPALLTRDALAALADAPGPVEHVAP      420
421      YLRPGAMTSLLNQLLHTNLRTKGAHHILTKVERLTAASGIEGRAPLFDRAVVDHAFAVPP      480
481      TMKLAGTSEKWILKQAVRDLLPKTIVDRPKSGMRVPVQQWLDGPLRELAHDLLLGRTARE      540
541      RGLFRADTIRAWLRGEGALLPRQGGKLWLVLSLQLWLRSFDLEESVR                   587

>MER0042627 - acetylornithine deacetylase ArgE [M20.974] peptidase unit: 1-452 ( active site residue(s): 95,159 metal ligand(s): 93,125,160,187,427 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSATGEVTGPNNSRAVAEVVELVSRLIRFDTSNTGDLATTKGEQECAEWVGEKLREVGYT       60
61       TEYVESGAPGRGNIFARLPGADPGRGALMMHGHLDVVPAQASDWSVHPFSGAVRDGYVWG      120
121      RGAIDMKDMVGMMLAVARQFKAEGTVPPRDIVFAFLADEENGGRWGSQWLVDNRPDLFAG      180
181      VTEAVGEVGGFSLTVPRRDGGERRLYLVETAEKGLGWMRLRAKARAGHGSFLHEDNAVTI      240
241      LAQAVARLGTHTFPLVLSDSVAEFLAVVAEETGLPFDPTGPDIEGQLAKLGTISRIIGAT      300
301      LRDTANPTMLQAGYKANVIPQTAEAVVDCRVVPGRQAAFEREVDELIGPDVEREWITKLD      360
361      SYETTFDGHLVDAMNEAILAHDPEGRTVPYMLSGGTDAKAFARLGIRCFGFAPLRLPPDL      420
421      DFSALFHGVDERVPVDALEFGTRVLEHFLLHS                                  452

>MER0041234 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 1-281 ( active site residue(s): 24,27,108  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLDPVSPDAWCLHSAAVTVTPVYSIAKIFTAAAALRCLDPEREIGAVAPVPARLAGLRVG       60
61       DLLTHRSGLGDYGAWPEYRRAVAERGDAWPEEVILERVELARPGVFRYSNPGYLLVRRAL      120
121      EEQHGDRFFPVLRRLVLDPLELPAHPFASRADWAHCTVEIPAGVRAYDPRWVYPGTFCAD      180
181      VTDTAAALARLLSGTLGAELPTAMCRTHPVDAPGHPLSDPGYGAGLMTSGNPPAIVGHGG      240
241      GGPGFTLFAAARVDGSAAHGTVEARECDDAPLIRRCLAALR                         281

>MER0041281 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-312 ( active site residue(s): 135,260,289  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRPRFRPHARGVDFSTYAAFLPPSLRGEPLAAPEPTWWPWRGRQVHIARATRPEASARIL       60
61       AVHGAGGHAGLVWPFAALAARAGIDAAAVDLPLYGDTREPDPRGVRYRDWVDLLTDLVRA      120
121      ETDADPRPLILFGASIGGLLAYEAAARSGRVAHVLATCLLDPADPAARRAAARWSWTGAA      180
181      APTLLGALGPAARLRVPIRWLADMANMSADPAVSRACATDPRGGGIRVPLGFLADYFTFE      240
241      HTRPQHYTAAPVTLVHPAADRWTPPELSLRFLDRIAAEHRAVLLANCGHFPLEEPGVHVL      300
301      RETIEAVIAATT                                                      312

>MER0041957 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 2-263 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCRLFGLSAAPERVHATFWLLEAPDSLAEQSRREPDGTGLGVFDEHGAPVVRKQPIAAYR       60
61       DAAFGREAQEFVSQTFLAHIRYASTGGLSAVNTHPFTQHGRLFAHNGVLGDLERLDAELG      120
121      EYRALVAGDTDSERLFALITMQIDAHDGDVGAGIAAATRWVAVTLPVFAINLVLITATEL      180
181      WALRYPDTHDLFVLRRSAGGRHGRHLEHSGSAGRMRARSGPLARYPAVVVASERMDEDPG      240
241      WENLPVGELLRVGADQAVTRHRILDRPPRHRLTLRDLDPHAAASQSPS                  288

>MER0042186 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 58-224 ( active site residue(s): 199 metal ligand(s): 120,124,201 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPVTDPLSFLRPGAPRSRRRRVAGRAVALSAALGVSFGVFAAADPADGTASATAAVADAT       60
61       EETVQFTAFTPREAQMPQIVPEPVLWEQHRLAVEAARPKTVRPVAGVLTSHFGARWGAQH      120
121      NGLDFGDPIGAPIAAVTDGVVIEAGPASGFGLWVRVQQDDGTVGVYGHVNDILATVGQQV      180
181      RAGDVIATVGNRGYSTGPHLHYEVHAPGVGPIDPAPWLAARGVDVFAPSH                230

>MER0042783 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 12-208 (Nocardia farcinica) (Source: MEROPS) 
1        MRTQLLIGGRFYSSSSPDATAMAVQDGTIVWLGAEQPGRALHPDAEIVDLDGAFVAPAFV       60
61       DPHVHVTALGLRLIGLDLTATGSLAECLAAVRAHAAEHPEAAVLGTGWDETRWPERRAPS      120
121      AEELDAAAGPGRRVYLARVDAHSAAVSSALLALVPAGTRGHTPGAPLRADAHHLVRAAAL      180
181      AGLDRAQRDRARRAALDAAAAHGIVAVHECAGPDIAGRDDLRELLDVEHGVEVRAYWGQA      240
241      VGSAAEATALLAEVGAHALGGDLFVDGSLGSRTALLRAPYADGPGTGVSYLDADAIGAHV      300
301      RACTEAGIQAGFHVIGDAGMDAVVAGFEQAVAALGGPAVAARGHRVEHAEMLDAAQIDAL      360
361      ARWGVIASVQPVFDATWGGPDGMYAARLGAERAAGLNPYAAMAAAGIALAIGSDAPVTEL      420
421      NPWAAVRAASLHRTPGHGISPRAAFAAATRGAWRAGGVRDGVAGTLVPGAPASYAIWEAG      480
481      ELVVAAAADSVQRWSTDPRSRVPGLPALEPDSPLPRCLRTVHRGVTIYQA                530

>MER0041294 - family U62 unassigned peptidases [U62.UPW] peptidase unit: 1-497 (Nocardia farcinica) (Source: MEROPS) 
1        MSTATSGGPRRAVDAEFRALPLAALADAALTAARAAGAEHADLRVHRLRTQSIRLRDGRV       60
61       EAVADSTDLGFAVRVIVDGTWGFASHAALTPATAAEVARRAVTVATALRALNRERVELAP      120
121      EPRYPGAEWVSAYDIDPFTVPTAEKVALLQDYSERLAAADGVDHVSAAVLQVKEQTYYAD      180
181      TAGTVLTQQRVRLHPQLEAITVDSAAGVFETMRTLAAPAGRGWEYVTGADGVWDWDAELA      240
241      RIPGWLAEKVKAPTVSPGPTDLVIDPTNLWLTIHESIGHATEYDRAIGYESAYAGTSFAT      300
301      PDKLGTLRYGTPIMHVTGDRTEPHGLATVGYDDEGVAGQRWDLVRDGVLVGYQLDRAFAP      360
361      RLGLDRSNGCSYADSAHHVPIQRMANVSLQPDPARDTSTAELIGRVEDGLYIVGDKSWSI      420
421      DMQRYNFQFTGQRFFRIRNGELAGQVRDVAYQATTTDFWGAMEAVGGPSTWQLGGAFNCG      480
481      KAQPGQVAAVSHGCPSILVRGITILNTRTEAGR                                 513

>MER0041295 - family U62 unassigned peptidases [U62.UPW] peptidase unit: 1-461 (Nocardia farcinica) (Source: MEROPS) 
1        MSVQGVPPAGAVVEQALALARADETIVMVTDAHEASLRWAGNSMTTNGASVSRQWAVVSI       60
61       FRDGPRAARVGSVGSTSVDPAEVATVVRAAEAAARSAEPAKDAMPLLDSTDSVEDWAAEP      120
121      GTTGIEVFTELARGLADGFDAADRLYGFAHHQVHTTWLGTSTGLRRRFVQPTGSVEINGK      180
181      RGPRDAPSSAWVGVGTTDFTDVDVPALLSELSGRLDWAARRVELPAGRYETLLPPSAVAD      240
241      LMISLMWAMEGRGAHEGHNAFARPGGGTRIGERLTELPLTLWSDPRAEGLAYRPFVATPE      300
301      SSETLSVFDNGLLADRVDWVREGVVHALAYPRATAAEFGATPTVPGENLLLTGGSAASTA      360
361      ELVARTERGLLLTTLWYIREVDPATLLLTGLTRDGVYLVEDGRVTAEVNNFRFNESPLDL      420
421      LRRVTEAGATEATLPREWKDWFTRAAMPPLRIPDFHMSSVSQAT                      464

>MER0042239 - subfamily M24A unassigned peptidases [M24.UPA] peptidase unit: 1-256 ( active site residue(s): 83 metal ligand(s): 100,111,174,207,239 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVELKTPAEIERMRVTGAFVADVLADLRARAQVGVNLLDLEAHVRERIRQRGAVSCYWDY       60
61       APSFGRGPFRNTVCLSVNDAVLHGMPFDYRLRDGDVLSMDLAVSIDGWVADAAVTVIVGT      120
121      ARAEDQRLVRATEDALAAAIEAAVPGNRLGDISAAIAAVASAYGYPVNTEFGGHGLGRTM      180
181      HEDPHVANVGRPGRGMTLRPGLTLALEPWFARTTDRIYIDDADGWTVRSADGSRTAHSEH      240
241      TVAITADGPLVLTRAA                                                  256

>MER0041199 - PH0974 dipeptidase [M24.034] peptidase unit: 145-373 ( active site residue(s): 216,305,316 metal ligand(s): 233,245,309,338,352 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSSHTHARFAADVYADRLERAVESMRAAHLDALLITPGPDLRYLVGSAAQSFERLTCLVI       60
61       TSDGATPSVVIPKLELAALADSAVGELGLRVLDWVDGVDPYQLVRSTLHAGSRVAVADAM      120
121      PALHLIPLAASFSGLPVSATPVLRELRMIKDAAEIEALRRAGAAIDRVHARMGEFLQVGR      180
181      TEAEVGDDIAAALVEEGHLEADFVIVGSGPHGADPHHGVSQRRIERGDVVVIDIGGPVEP      240
241      GYFSDCTRTYSMGEPASEIAARFAELERAQAAAVAAVRPGVTAESVDAAARNLLTEAGFG      300
301      DAFVHRTGHGIGLSVHEEPYIVAGNDLPLRPGMAFSIEPGIYFRGEWGARIEDIVVVTED      360
361      GCESMNNRPHGLTVL                                                   375

>MER0037026 - bacterial proteasome, alpha subunit [T01.980] peptidase unit: 8-235 ( active site residue(s): 19  ) (Nocardia farcinica) (Source: UniProt Q5YUX3) 
1        MTLPYYASAEQIMRDKTELARKGIARGRSVVVLTYDKGVLFVAENPSATLHKVSELYDRI       60
61       GFAAVGKYNEFESLRRGGILQADLRGYQYDRRDVTGRALANAYAQALGTVFNDQLKPFEV      120
121      EICVAEVGYPEQSPEAVLYRINFDGAIVDEREFVVMGGTTEPIVAALKDSYQPGLDLSSA      180
181      VGVAVQALQASGPEGADKEKRTIGVSQLEVATLEQARPRRAFRRVTKTALEQLLVGNGVD      240
241      TSVGKATTTVELPEEPAE                                                258

>MER0042512 - bacterial proteasome, beta component [T01.005] peptidase unit: 56-270 ( active site residue(s): 58  ) (Nocardia farcinica) (Source: UniProt Q5YUX2) 
1        MTAGDPMRLHPGHALSSFTEHLRALAPELLGPNRFAALDGATGSSGGTGAKDIAPHGTTI       60
61       VAVSYRGGVLIAGDRRATQGNLLASRDMDKVYITDTFSAAGIAGTAGMAVELVRLFAVEL      120
121      EHYEKIEGVPLTFDGKANKLSKMVRDNLPAALQGLAVVPVLVGYDERAGDPDRAGRIVSY      180
181      DVVGGRSEERFGYTAVGSGSMFAKTSLKKLYAKGIDQARALRIALESLYDASDDDTATGG      240
241      PDLLRGIYPTAVVIDAEGALEVPESRLEEIARGIVADRTAAQEGSAGA                  288

>MER0398061 - Dop isopeptidase [U72.001] peptidase unit: 1-498 (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MQRIIGIEVEYGISTPTEPSANPILTSTQAVLAYAAAEGVPRARRTRWDYEVESPLRDAR       60
61       GFDLSRMNGPAPVIDADEVGAANMILTNGARLYVDHAHPEYSAPEVTDPLDAVIWDKAGE      120
121      RVMEAAARHASSVPGAPRLQLYKNNVDGKGASYGTHENYLMNRDTPFNQIIVGLTPFFVS      180
181      RQVICGSGRVGIGQSGDQSGFQLSQRADYIEVEVGLETTLKRGIINTRDEPHADADKYRR      240
241      LHVIIGDANLAEMSTYLKVGTTALVLDLVEAGEDLSDLQLARPVTAVHQISHDPTLRVAV      300
301      AMADGRELTGLALQRLYHERVAKFMDREGNDDPRARDILENWAMVLDLLERDPMECANLL      360
361      DWPAKLRLLEGMRSREGLNWAAPKLHLMDLQYSDVRLDKGLYNRLVARGSMKRLVSEQQV      420
421      LDAMTNPPTDTRAYFRGECLRRFGADIAAASWDSVIFDLGGDSLVRIPTLEPRRGTKSHV      480
481      GKLLDGVDSAAELVEQLTH                                               499

>MER0469715 - DD-carboxypeptidase pdcA ({Myxococcus}-type) [M15.002] peptidase unit: 130-226 ( active site residue(s): 221 metal ligand(s): 188,195,224 ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MSRHGRVELSDTPIRVGVSLSECRASGGVIHRDLWICGLSLTVHCPPPARRPTRMIDRPG       60
61       CRATRSAPATMIAMSRRPQVITRRTLAAVLAGPVVLTGVLATATATAAPGEQREALGSAA      120
121      GTDGLDPALAVAYTLAEQAAHAEGVPLSITSGYRTPAEQQALWEDGLATYGSPEEARRWV      180
181      LPPEESTHVSGQAVDVGPQAGAQWLERNGNRWGLCRTYANEWWHFELATIPGGSCPPLRP      240
241      DASER                                                             245

>MER0041268 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-286 ( active site residue(s): 107,231,263  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNRNDLGHSLSQHTLDQIARANDSGNTPVVFIHGLWLLARSWDRWAELFAAAGYAPVTAG       60
61       WPDDPDTVEAARAHPEVFAGKTVGQVADHFAAVIERLDRTPAVVGHSFGGLLAQIVAGRG      120
121      LSAATVAIDAAPFRGVLPLPISSLRAAAPVLGNPANRHRAVPLTYEQFRYAFANAVDEAE      180
181      AKELFENFAVPAPGAPLFQAAAANLNPWSETKVDTHNPDRGPLLIVSGERDTTVPHAISK      240
241      AAYDKQRANPGITEFVEIPGRGHSLTIDSGWPTVAETALAFIRRFA                    286

>MER0210714 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 17-252 ( active site residue(s): 94,212,238  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MPQTALFRSLALCAVLAAPALLPATAAAEPPTVVLVHGAFADPTSWDGVAADLRADGFRV       60
61       VVPDNPLRGPASDAAAIERVLDGIDGPIVLVGHSYGGAVVTNVADPDVTALVYVAAFAPQ      120
121      QGEPTQLALDPVRYPGSRLLPPALAVTARDGGLEAYVDPARFHEVFAQDVDEATAADMIA      180
181      HQRTLALTANLEPSGPASWTTTPTWYVVAAEDRVIPPASQRAMAARMGAVVSEVAASHAC      240
241      LVSAPGAVADVIAEAARR                                                258

>MER0041170 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 48-160 ( active site residue(s): 95,109,110  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIPVQVLRPGPELTRRRRIGVLVFDGVKMLDFAGPAEVFVEANQSVPGYEVVMLSPDGAP       60
61       VHTSIGTQVGVTGSALAAHDLDTVVIPGSEQPPARFVTPEVLAATAHLAARTRRLASICS      120
121      GAFVLAELGVLDGRRATTHWKFTRDLAARYPRVRVEPDAIFVRDGRVYSSAGVAAGIDLA      180
181      LALVEEDHGAAVARRVAQSLLVFMQRAGGQSQFSAALTGPVPRSALVRELTDLIYADPAR      240
241      PYPVQMLAAHARVSTRHLTRLFREELDSSPAEYVAHVRFAFARDKLDAGHSVTEAALLAG      300
301      YGSSEAMRRAFVARLGVSPKKYQQRFRTTAPDRDTTRV                            338

>MER0041225 - subfamily S9C unassigned peptidases [S09.UPC] peptidase unit: 58-310 ( active site residue(s): 162,259,289  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAGNPHNLPLEAAAQEFVDATSQPPFLYQLPPEEGRKAVDAVQDSPIEKPAIDEEWITVP       60
61       GGPTGSVRARIVKPPAVEGPLPVIVYTHGAGWVFGNAHTHDRLVRDLAIGARAAVVFPEY      120
121      DRSPEVHYPVANEQSYRVAQWVAAEGASKGLDSTRIAVAGDSVGGNMAIALTLMATERGD      180
181      LSFVQQVLFYPVTDANFDTGSYEQFAEGYFLSRAGMRWFWDQYTTSESDRAQITASPLRA      240
241      SIEQLAGLPPALVITAEADVLRDEGEAFAGKLRAAGVPVIQTRYGGIIHDFVMVNSMHGT      300
301      EAAQAAVAQAVSVLRAALHGA                                             321

>MER0042716 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-234 ( active site residue(s): 77,191,211  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSTFVLVHGSWAGGWHWADIRARLEQAGHRVHAPSLTGMADRHHLAGEHVGLHTHIDDVA       60
61       RLLEWERLTDVILVGHSYGGMVITGAAARVPERIAHVVYLDAFLPRAGEAAWDLLPWQRE      120
121      AFQQLRLPDRPWLVRPVDAAAFFPELGEDFDDNRPTPMPIATHEQPVPDAPAPGALPGTY      180
181      IHCTAAPAYFDDVARRAADDGLAVVTLDAGHMALLTHADEVSATLLELAQEAPR            234

>MER0041283 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-278 ( active site residue(s): 95,219,247  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDVQRRNRIVVTGQAGAPVVVLAHGFGCDQNLWRLVVPLLAPDFTLVLFDHVGSGGSDLS       60
61       AWNAERYGTMQGYADDVVEVCRAIDAGPVVFVGHSVAATMGVLAAAAEPELFRGLVLLAP      120
121      SPCFIDDPARGYRGGFSAADIDELLESLDANYLGWSGAAAPMIMGNPDRPELAAELESSF      180
181      CRTDPEIARVFARVTFLSDNRDDLAAVTVPTLVAQCSHDAIAPPEVGEFVHARIPGSELI      240
241      TLSATGHCPQLAAPEETAAAIATFVRKLPARAPTTATR                            278

>MER0041216 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 52-302 ( active site residue(s): 156,251,281  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSVPPLDPDVAARVAALGTVPSMRSRGIEAVRSGVEAMAPPTSMPAVAQIENHTVPGPYG       60
61       PLDLRIYRSTTGPAAPVVIHLHGGGLAMGSNASFEPLARHLARASGATVVGVDYRLAPEW      120
121      PAPVQVEESYAATVWVAEHARELRVDPERLVVLGDSAGGGLAAGVALMARDRGGPALFAQ      180
181      VLLYPGLDRDLGAASVVAMPDAPMLSREDILYLHELADAGSSRPADCYRVPAYATDLSGL      240
241      PQAIVVTAAGDPIRDWGERYAARLRDAHVQTTLTRYPGVLHGFLMRPENSARALLAIAET      300
301      GALLRAKFDNALPWPTRAAGS                                             321

>MER0041221 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 56-313 ( active site residue(s): 167,262,292  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTVPTGHPPYRFAWDPDVAVLVAAIESHRAGTLRDGGVAAARRSLESIVRPPGPAMASVR       60
61       DASIEGPHGDIPVRVYRPHTAPESDASALVWFHGGGMIMGSLHSFDRLARDIADATGAVV      120
121      VNVEYRLAPEHRYPVANDEAYAALCWLHENAAAWGVARSRIGVGGDSAGGSLAAATALRS      180
181      RDEAGPGIAQQVLFYPGIERRTDRPSMREFGDSPFLTAADIDWMKSLYLGEDPATDDAYG      240
241      VPALADSLAGLPPAIIAVGYADPLRDAVEAYGDRLRAAGVPTAQLRYPGMGHGFAMQTAN      300
301      VARARAAMAEVGALVAARFRHEP                                           323

>MER0041166 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 341-462 ( active site residue(s): 386,435,447  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRESRRAGQRSKLWVAVGLLICTALVVSAGPGTAVPPPPPNPSDGQIADAGARVEAGIGE       60
61       VGALINQVADVEHQLRELDDAVAVRREEVNKALVDLQNARAAADAAAARVETTQRDLATA      120
121      GEEVARARHNFDDFATRAYTRPASGSMVTYLAAATPTGAIDRSEVLGLVSKNQQQVLDAL      180
181      RRAQIEQGNRNSDAREAKSLADAAAAAAEQKKAEAESAVAAAKAALDSETVRRDGLLRER      240
241      DAAQSRLDAARANVQGLQNQREAYQAWDAQRRAEEAEAIRVAAAAAAARAAADQAARERA      300
301      AQLGEGKRPHTELEDAPAPKKSTTPKPSSPSVSGSAAVEVVVDRALSQLGVTYAWGGGDE      360
361      DGPTLGIRDGGVADSYGDYNKVGFDCSGLMVYAFAGIGVSLPHYSGYQYNAGTRVPLAQK      420
421      ARGDMLFWGPGGSQHVALYLGDGKMVEAPQSGDVVKVSPVREDGIMPYAVRIVTS           475

>MER0042667 - family S15 unassigned peptidases [S15.UPW] peptidase unit: 56-533 ( active site residue(s): 123,244,270  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRIVEKFPYEVLDTENVFIPMRDGARLAARIWRPVTDEPVPAVFEYIPYRKRDLTRARDA       60
61       LNHPYLAGHGYVSVRVDLRGSGDSDGVLTDEYLPTEHDDACDVIAWLADQPWCDGNVGMM      120
121      GISWGGFNSLQVAARRPPALKAIVSASATEDLYVDNMHYMGGCLLSDNLSEATVMFAFNS      180
181      LPPDPAIVGDRWRDMWRERLAGSGLWIEQWLEHQHRDEYWKRASVNEDYRAVDCPVLAVG      240
241      GWADGYTNAIFRLLEHLDVPRRGLIGPWGHKYPHLGVPGPAIGFLQELVRWWDHWLKGRD      300
301      TGVMDEPMLRAWMQDSISPQPSYADRPGRWVGEPSWPSPNIVPREFTLTRYGLAEDAGDV      360
361      PARTMRVQSPLSVGMFAGKWASYAATPDLPSDQREEDGGSLVYETEELTETFEVLGQPEL      420
421      ALTVAADRPNAMVAARLSDVAPNGEATRVTYGLLNLTHRDGSGEPRPLEPGRTYRVRLAL      480
481      NGMAHSFPPGHRIRLSISSSYWPLAWPSPEPVMLTVTTGESLLTLPQRPRRAEDERLRPF      540
541      DDPEAAPPAPATNIERGTHHWKVERDLATGVSTLEIENDQGLIRLDDTGTLVRRATTEWF      600
601      SFRGNDPTSVRGETRTVRAFARDNWRTEITTHTVLRCTPQDFVLDARLDAYELGDPADDP      660
661      RPVATRVYSQNWHRRIPRDLV                                             681

>MER0041282 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-255 ( active site residue(s): 94,215,243  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAVLRTPAGPVGYTDDGTGPALVFVHGFLFDKRMWAPQVARFTARGYRVITVDMVGFGAS       60
61       TATSATVPMGAHSAALAAVLAACDVDTVVLTGYSMGGQVALDFVAAHPGRVRALVLSDTF      120
121      AGLDSAEVKASRFALADRLAADGVADYAEEFLPLVLSPRTVAQRPAVAERARTMMRAADP      180
181      AGAAAALRGRAERRDYTGVARAVDVPALVIVGAEDQFDRGVLGADLAATIPDAHLTVIDE      240
241      AGHTPNMERPEAFDDALAAFLDSLTRVG                                      268

>MER0038373 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-325 ( active site residue(s): 104,268,301  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTVTERPTSRIVTNDGIRMHVTERGAGQPVIFCHGFPHTGFIWHRQLDALAAAGYHALAP       60
61       DLRGYGRTDAPADPEAYTNRAVIGDLLALLDDLAAERAVFVGLDFGAVLVWELAQRAPER      120
121      VRGVIVLNNPYAPRPSRAPSQLWAKAAQRHFLHLDYFQRPGVADRELAAAPRDFLARVYY      180
181      ALSGDYHYLDTWRFPPGSGYLEVLPDAPALPWPWLSAAEFDVLAAEFERTGFSGGLAWYR      240
241      SLDRNWELGADLDPTVRVPAYFVYGEKDPDMAGFSGRDPLGVMRAHVPDLRGVTEIPGAG      300
301      HLLPLERGAEVDRLVLAHLTDLGLA                                         325

>MER0041292 - gamma-glutamyltransferase 1 (bacterial-type) [T03.001] peptidase unit: 39-627 ( active site residue(s): 431  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLTGCSAGDEPVAQPCTSTENGSAITAEPSAAATATTQNLALNPEIASGYRAGMTPVETG       60
61       SYAVSTANPIATEAACAVLRDGGTAADALVTAQLVLGLVEPQASGIGGGAFLLYYDAASG      120
121      GIDAYDGRETAPVAATENYLRWISDTDRTEPRPDTRASGRSIGVPGVLRMLELAHREHGK      180
181      TGWRELFDPAIALADQGFAISPRLAAQIAESAPELARDEAARAYFLQPDGTGKPAGTTLT      240
241      NPALAKTLSTIATDGADAFYTGVLAENIVAAVASDAGGRTPGLLSTADLAGYQVKKRTAL      300
301      CSAYRAHEICGMPPPSSGGSTVAATLGILENFDLAALGPQEVDRDGGTPRAEAVHLIAEA      360
361      ERLAYADRNKYVADPDFVPLPGNSAQSLIDRNYLKQRAGLIDPQRSMGTAQPGDLGPVPV      420
421      GVGPQPPEHGTSHISVVDRYGNAAAMTTTVESAFGSFHMVDGFVLNNQLTDFAADPVAPD      480
481      DAPVANRLEPGKRPRSSMAPTLVFDRAPDGGRGQLTHVTGSPGGAVIIQFVVKTLIGMLD      540
541      WGLDPQQAVSAVSFGAGNSPTTGVGGEHPAIDATDNGDHDPLVRRLRELGHDVSVAPQTS      600
601      GLSALRRAEPGWIGGADPRREGAVLGDIR                                     629

>MER0041162 - family C26 unassigned peptidases [C26.UPW] peptidase unit: 76-372 ( active site residue(s): 258,348,350  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSADTAAALVLEDGRVFRGTAYGAVGQTLGEAVFCTAMTGYQETLTDPSYHRQIVVATAP       60
61       QIGNTGWNDEDDESQRIWVAGYAVRDPARRVSNWRATRSLPDELDRQGIVGIAGIDTRAL      120
121      VRHLRTRGSMKAGIFSGAALADAEELLARVTGQPSMLGADLAEEVSTDGVYTIEPTGDHR      180
181      FTVVAVDLGIKTNTPRMFAQRGIRVHVVPSTTSLDQVLELKPDGVFLSNGPGDPATQNDA      240
241      VAITQGVLERGVPLFGICFGNQILGRALGRETYKMKFGHRGINIPVVEHETGRISITAQN      300
301      HGFALEGERGEQFDTPFGRAEISHVCANDGTVEGVRLLDGRAFSVQYHPEAAAGPHDAAY      360
361      LFDRFAGLMEGA                                                      372

>MER0042288 - family M38 non-peptidase homologues [M38.UNW] peptidase unit: 4-381 ( active site residue(s): 301 metal ligand(s): 57,59,172,229,259 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSGLLIKGAVLYGEGEPVDVFVDEGEIRQIGTDLGVVDAEIVEARGQVLLPGFVDLHTHL       60
61       REPGREDTETIETGSAAAALGGYTAVFAMANTNPVADSVVVTDHVWRRGQEVGLVDVHPV      120
121      GAVTVGLAGKQLAEMGTMAAGVGGVRMFSDDGHCVYDPLIMRRALEYSNSLGVLIAQHAE      180
181      EPRLTKGAVAHEGPTAARLGLAGWPRAAEESIVARDALLARDAGARVHICHASTAGTVEL      240
241      VKWAKAQGISITAEVTPHHLLLDDSRLETYDAVNKVNPPLREASDTAALRAALAEGIIDC      300
301      VATDHAPHAEQDKCCEFAAARPGMLGLETALSIVVETMVRPGLLDWRGVARVMSERPAEI      360
361      VGLDDQGRPIAVGEPANLVLVDPDATWTVRASELASISNNTPFEEMTFPARVTMTLLRGR      420
421      ITARAGRAAQPQGAGGA                                                 437

>MER0041198 - subfamily M24B unassigned peptidases [M24.UPB] peptidase unit: 142-375 ( active site residue(s): 216,304,315 metal ligand(s): 233,244,308,337,351 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSADPAGLVPDYAARRGALRSLLVENEVDALLVTDLVNIRYLTGFTGSNAALLVHSWDMR       60
61       NAEDRTVLGTDGRYRDQVAAQVPDLRAEIARATARRIVELAGEWQLGRIGFESHAVTVDQ      120
121      HRGFVEQRTGLEFVATPGLVEQLRMVKDAYEVEQLRRACAAGDAGLAALLARGGLRPGRT      180
181      ERQVARDLEWAMFEHGAEAVSFETIVATGVNSAIPHHRPTDAVLAPGDFVKIDFGAVVDG      240
241      YHSDMTRTFVLGHAADWQREVYELVAEAQRAGSKALRPGVAAGEVDAASRSVIEAAGHGK      300
301      LFVHGLGHGVGLRIHEAPGIAKNAPGTLLSGVAVTVEPGVYFPGRGGVRIEDTLVVREGG      360
361      PELLTHTSKDLTVVD                                                   375

>MER0041158 - subfamily A24A unassigned peptidases [A24.UPA] peptidase unit: 8-140 ( active site residue(s): 20,77  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSFAFVLLAAWCAALTVIDLRTRRLPNVLTGIGAAAVLGYAAGSGRLGVALGGALLLAL       60
61       PYLLVHLLAPTACGAGDAKLAVGLGAAAGLGGSTAWVAAALGGPLLTAAVGLVVLGARGP      120
121      ATRGSPADRRLPHGPAMCAATLLALLPVAG                                    150

>MER0451317 - imidazoleglycerol-phosphate synthase ({Pyrococcus furiosus}) [C26.A32] peptidase unit: 39-227 ( active site residue(s): 114,213,215  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MTGREPGHSAAARKLGRVNQTSVSAPAAEPQAAPSRPTIGVLALQGDVREHLAALRACGA       60
61       EPVLVRRVGELEAVDGLVLPGGESTAISKLLQVFDLLDPLRARLRDGMPAFGSCAGMILL      120
121      ASEVLDTRPDAQHLSGIDMTVRRNAFGRQVDSFETDLDFAGLDDGPVRAVFIRAPWVERA      180
181      GDGVQVLATVPDGPSRGRIVAVRQGNVLATSFHPEVTGDLRVHRMFVDIVRAAGDRAGNV      240
241      HTPDVQPT                                                          248

>MER0041247 - repressor LexA [S24.001] peptidase unit: 133-243 ( active site residue(s): 167,204  ) (Nocardia farcinica) (Source: UniProt Q5YT43) 
1        MSRTDDTGEESGVAVDPALNGADLTVRQRKVLEVIRTSVSERGYPPSIREIGDAVGLTST       60
61       SSVAHQLRALERKGYLRRDPNRPRAVDVRGLDEAVRAVTALPGAALEEPDTLAEDTGRPT      120
121      PTFVPVLGRIAAGGPILAEQAVEDVFPLPRELVGDGSLFLLRVVGQSMVDAAICDGDWVV      180
181      VRQQNVAENGDIVAAMIDGEATVKTFKRTGKDVWLMPHNPLFEPIPGNDARILGKVVTVI      240
241      RKI                                                               243

>MER0041189 - BSSC8_26020 g.p. ({Bacillus subtilis}) [M16.A15] peptidase unit: 36-269 ( active site residue(s): 79,149 metal ligand(s): 76,80,156 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSKKKTTTPLIPSGQGGPSLRQRVDEAVDSGVRRTVLPGGLRVVTEHVPGVRSASIGVWV       60
61       GVGSRDEGRTVAGAAHFLEHLLFKATPTRSALDIAQAMDAVGGELNAFTAKEQTCYYAHV      120
121      LDEDLPLAVDMVSDVVLNGLCRSADVDVERQVVLEEIAMRDDDPEDLVGDAFLTALFGDH      180
181      PIGRPVIGSVESIESMTAAQLRGFHQRRYRPDRMVVAVAGNVEHEHTVELVHRAFENRLD      240
241      PAAQPAPRREGRFRPHGAPELQWSFRDSEQAHLVFGVRAFGRHEGERRWPLSVLNTVVGG      300
301      GLSSRLFQRIREERGLAYSVYSSVDTFADTGAFSVYIGCQPENLGEVARLAKGVLEEVAE      360
361      HGVTDAECARAKGSLRGGLVLGLEDSASRMNRIGRSELSYGNHRSVSETLARIDAVTTEE      420
421      VAAIARTLLSRPFGVSVAGPYRRTRDLPAAVRRLVA                              456

>MER0042820 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 58-331 ( active site residue(s): 136,279,308  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSDITAASGARWRPDVLGADYEQHTIELGADPDGEGDIAATLVRHVPGSASEATDCAVLY       60
61       VHGFTDYFFQRHLAEHFAARGHRFYALDLRKCGRSLRSGQSPHYVTDLAFYDAELDEALR      120
121      IVRAETGAPVLLVAHSTGGLIVPLWLDRRNRAGGTAAAGVIGLVLNSPWFDLQGPSYYRT      180
181      IGTPLIDALGRFRATSRLPGAGISTYGDSLHKSVAGEWDYNLDWKPLAGAPVRFGWLRAI      240
241      RRGHFRLHQGLDVGVPSLILRSRLTKFLRKYGPAADVADTVLDVKQIQRWSGCLGDRTNI      300
301      VPIDGARHDVFLSSEQPRAQAFAELDRWLDWLAEYRRAAASPETGA                    346

>MER0042240 - methionyl aminopeptidase 1 ({Escherichia}-type) [M24.001] peptidase unit: 39-287 ( active site residue(s): 116 metal ligand(s): 133,144,207,240,271 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSVRTRQPLVPGTPTPIREVPRSIERPEYAWKKTAKEGSEPWVQTPETIEKMRIACRIAA       60
61       QALEEAGKAVAPGVTTDELDRIAHEYMCDHGAYPSTLGYKGFPKSCCTSLNEVICHGIPD      120
121      STVIQDGDIVNIDVTAYIHGVHGDTNKTFLAGDVDEEVRLLVERTEEATNRAIKAVRPGR      180
181      ALNVIGRVIEAYANRFGYGVVRDFTGHGVGPTFHNGLVILHYDQPAVETVIEPGMTFTIE      240
241      PMINLGGIDYEIWDDGWTVVTKDRKWTAQFEHTLVVTETGAEVLTLP                   287

>MER0041261 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 14-280 ( active site residue(s): 108,240,268  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSTPVDTLAVPELRELTTEHGVLRYRECGDGPPLLLLHGSGPGVTGWRNFGGNVPVFAEH       60
61       YRTLVLEFPGFGVSDDFGAVHPMLSAQQAVRAFLDGLGLEQVRIIGNSMGGFVATDFAIA      120
121      APERVERLVTIGGIGTPLFSAQPGEGIIRLGEFVDNPTRERLIAWLRSMVFDQSLVTEEL      180
181      IEQRWQQATDPATLENSRRMYGSAALARMAEAARAADTTPGWANLGRITAPVLVTWGRDD      240
241      RVSPVDMALLPMRTLRNGEVHIFPNCGHWVMIEQKRAWEAVVLAFLGR                  288

>MER0041217 - hormone-sensitive lipase [S09.993] peptidase unit: 59-307 ( active site residue(s): 163,256,286  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTEMGAQRRSDLHPDVAAMLAALESFPDVTRYEAAELREIIAARRAPLTRQPDMRTARDH       60
61       VIPGPGGDLTVRVYVPHGDALRPVVVFAHGGGFVFCDLDSHDEFCRSTAQAVDAVVVSVD      120
121      YRRAPEHPGPAAMEDLYAAVTWVHRHAGEFGGDPERIAVAGDSAGGNLAATVSLAARDRG      180
181      GPPIAAQVLIYPVIDDDFDTESYRRYGAGYYNTTEAMRWYWQQYAPHGTDSPYLVPTRAD      240
241      SLAGLPPAVVVTAELDPPCSAGEDYARRLAAAGVPVTAHRFDGLFHGFLTFPKLSLTGPA      300
301      RAELWQMMRAVLASPRPAVGEGTA                                          324

>MER0042463 - protein Rv2869c ({Mycobacterium tuberculosis})-type peptidase [M50.005] peptidase unit: 1-399 ( active site residue(s): 22 metal ligand(s): 21,25,335 ) (Nocardia farcinica) (Source: MEROPS) 
1        MVFAVGFVLFALGILISVALHECGHMWAAQATGMRVRRYFIGFGPTLWSFRRGETEYGLK       60
61       AIPLGGFCDIAGMTALDEVRPEELDRAMYRQATWKRLVVMVGGIVMNFLLGFLLIVVLAI      120
121      GWGLPNLDEPAPVVGQMQCVADQNPDRSQQQCTGAGPAEQGGLRPGDRVTAVNGVAVSTW      180
181      AEFTEQTRKQQGPIAYTVDRGGQTVQVTVTPQRVLRYATDGSSAQVSAIGITLDAPPAVI      240
241      EYSPVSAIPASVAFTGDLFVRTFEALAQMPAKVAALWEAVTGGERDPETPVSIYGASRIG      300
301      GESVEAGLWEVFVLLLASLNFFLGAFNILPLLPLDGGHIAVVLYEKVRNTVRGWRGLAPG      360
361      GPVDYLKLLPLTYAMVAIGGAYMVLTLAADIVNPIRLAP                           399

>MER0041249 - signal peptidase ({Mycobacterium tuberculosis}-type) [S26.024] peptidase unit: 55-251 ( active site residue(s): 68,141  ) (Nocardia farcinica) (Source: MEROPS) 
1        MADESGSVRVSESDDEGAGRRGRRRGNRKTKQQRPFWQELPILIGIAAIIAALVVTFIGR       60
61       PYVIPSQSMEETLQIGDRIYVQKISYYAGDPQPGDVVVFVGPPSWNTRYQSIRSDNPVVR      120
121      GVQNFLSFFGLVPPDENDLVKRVIAVGGQTVQCCDAQGRVMVDGKALDEPYVQNDYRWLT      180
181      GQQNASYPAGRVFGPIKVPEGHLWVMGDNRNQSADSRAHVGDELQGTVPIENVRGKAVFK      240
241      IWPPTRLGPIRAEDPQGN                                                258

>MER0038257 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 7-327 ( active site residue(s): 248 metal ligand(s): 21,23,117,147,156 ) (Nocardia farcinica) (Source: MEROPS) 
1        MRDAETLCDSGWIVPGLVDAHCHVGIRYGGGDEDHDGAIAQAEIERDAGALLLRDAGSPI       60
61       DTRFIDDHDDLPRIIRAGRHIARPKRYIRELGIELDDERDLPQIVAEQARRGDGWVKIVG      120
121      DWIDRAVGDLRPLWSDAVLVEAIEAAHAEGARVTAHVFGEDALPGLINAGIDCLEHGTGL      180
181      TDDTIAMMVEHGTALVPTLINIDTFPEIADSAGRFPVYAAHMRDLHRRVRDTIGNAHDAG      240
241      VPIYAGTDAGGSIRHGRIADEIAALGKAGLSAHEALGAASWAARDWLGRPGIAHGAPADF      300
301      VVYRDDPREHPDVLTEPAWVVLRGRVVKSADPVTGHR                             337

>MER0041264 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-282 ( active site residue(s): 112,243,270  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSNANYLLEPQTLRLRGSGGLELAADLFGPEDGPLVIFLHGGGQTRHSWKRTGAALAAGG       60
61       LRVVTLDARGHGDSQWAPDRDYSRAVMVADLLAVLDQLGATPERGAVVVGASMGGITGLL      120
121      ATAQPGGAAIRALVLVDIVTRPQPEGVERVMTFLGKHRDGFDTVEQAADAVAAYLPHRPR      180
181      PKNHDGLLRNLRHRDGRWYWHWDPDMIDGRTADADTDSMAALLEPAARALTIPVLLVRGR      240
241      MSDVVSEEAVAEFLEQVPHAQVVEIGNAAHTAASDDNDAFTDAVAEFVLAAAR             293

>MER0038359 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-252 ( active site residue(s): 88,198,230  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIGMSDEFAVRVDGATIPVVRAGRGRPLILCPGLLRRDHEVYSFDLRGHGVSSAAGRYTV       60
61       AGFLADVTAVLTRVRGRSAVAPVLVGYSLGADLVVHYASEHPGAAAELVLLDGANPVPEP      120
121      FVTDDDLPEFRAMFEDVAAWTASVADTPHRVLLTAADMLAVNREVDAMRAAILPRFARIE      180
181      CPVRMVMSTAMAGDDGDDRARRRNRNWRAGIERLVREHPHIRTRWLTAGHDLVHTRAEIH      240
241      RCRRRPGNWVPC                                                      252

>MER0041182 - PfpI peptidase [C56.001] peptidase unit: 34-176 ( active site residue(s): 87,113,114  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAELDGVRVLIVTSNTGVERDELLVPRDRLRERGARVTHAAPKPEQVQTFQHDLDPAQAV       60
61       EPDSALDGVDADDFDVLVVPGGTVNADKLRLEDRAVALAKDFAGAGKPIAAICHGPWLLA      120
121      EADLVSDKTLTSYPSLRTDLGNAGGRWVDEPVVRSTERDWTLITSRNPGDLDDFVTAIVR      180
181      EVSAR                                                             185

>MER0041274 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-294 ( active site residue(s): 115,254,282  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSQPRILAAAAERRVTVTTDDGVALAVREYGPRDAELTVVLVHGHCLRSESWTAVRDELL       60
61       RRHPHARVLCYDHRGHGDSAAAPRHTYQLDRLARDLRAVLDTLVPVGPVVLAGHSMGGMT      120
121      VLTYAGRYPREIGTRVVGVALLATAASGIADAGFGRLLRNPVVSAFQWAVRRAPRLMQRA      180
181      KLLACKLFAPVIRTAEFGDRAVSPQVLALANAMHNETSIVTMASFLSAFMSYDRTDALPV      240
241      LSAVPTVVLCGSADLMTPPAHSVAMAAAVEYSDLVIVDGAGHSVILEEPAQVAEVLGRLL      300
301      VRAGNRSAAYSLAA                                                    314

>MER0042744 - family M38 non-peptidase homologues [M38.UNW] peptidase unit: 26-189 ( metal ligand(s): 63,65 ) (Nocardia farcinica) (Source: MEROPS) 
1        MYDTIIKGGRWFDGTGAASAIRNLGIRDGRVATVSAAPLDEQGCARVIDATDRWVLPGMI       60
61       DIHTHYDVEVLGSPQLSESLRHGITTVLLGSCSISTVHVGPETAGDLFGRVEAIPRRHVI      120
121      DAVARGKSWSSAHEYAQALEELPLGPNVAAFIGHSDMRAAAMGLDRATRAGVRPDGAELD      180
181      TMARWLTEALDAGFVGMSSQQLRFDKLDGQYCRSRTLPSTFATARERRRLGDILRARGRV      240
241      LQGGPDASRPHTVVTMAAATLGLFRAPLKVSLLSAADLKALPAVIHLFSLLARTLNLLGG      300
301      NFRWQHLPVPFEVYADGIDLVIFEEFGAGAAAMHLADQVERRRDMLADPDYRRRFRRDYD      360
361      RRFGPRVWHRDFFDAEIVDCPDPRVIGKTFGQVGLDRGGLHPVDAFLDLVVEHGDKVRWR      420
421      TTISNHRPHVLDRLAAHPGVHLGFSDAGAHLRNMAFYNFGLRFLRRVHEAERAGRPFLSL      480
481      ERAVHRMTGELADWYGLDAGHLRQGDRADVVVIDPAHLDAELDRYAEAPVAQYDNLSRMV      540
541      NRNDAAVTAVLVGGEFVFGEGRAGDSVGVTRTGRFLRAR                           579

>MER0041259 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-269 ( active site residue(s): 91,236,257  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRAYSVDGIRYDIIGDGTPLVLVHGGSGRRQWFDPMTPLLERDARMLRVDLPGHGDSVPT       60
61       PGHYRLEESAAALHRVLDHAGWERCVVFGHSHGAHVAAVLAADHPDRVAGLVIGDAPFDR      120
121      ERMRAHHRATAPMNRAWRALTGAARPQAHTLAGFLALEIAGPGSPSIEDVFGREHPYVRE      180
181      MVASLRHHDGDFLDAVLDRFDDTYHRLDDALLRAVTCPVVLLAADPAAGGLVGDADIAYL      240
241      TDRAAGARVHRLSGVGHGLQLQDPRQVAEALRDHLRPQR                           279

>MER0041245 - SepM peptidase ({Streptococcus mutans}) [S16.012] peptidase unit: 177-291 ( active site residue(s): 231,276  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLAALVPVLVLGVLGTVFTVPFVALGPGPTFDTLGEFDGKQVVEVSGAELDPTTGHLNMT       60
61       TVSVRDGLNLFEAFGFWASGRHGIVPRAEVYPPGVPREEIDRSNEQEFKDSEGAAEVAAL      120
121      HYLRLPTVVLVRQVGEEGPAKDVLRPGDEFVSINGAPVTSPQDVVNAVSSQPPGAPLTVV      180
181      FRRDNAEQTATVTLAARPDDASKGFLGVTPGEGARPPMDVTFNLADIGGPSAGLMFSLAL      240
241      IDKLSPGELGGGKFIAGTGTIEQDGKVGPIGGIQYKMMAAREAGAEAFLVPAANCNEARQ      300
301      RIPDGLRLVKVETLDGAVQSLAALGSGGETPTCG                                334

>MER0041252 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-255 ( active site residue(s): 90,213,243  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVRVSTLHVHRFGPPDAPVVLALHGLTGHGARWAALAEEHLPDVRIIAPDLRGHGRSTAL       60
61       PPWDFETVVADLAELLRAETDGPVLVAGHSFGGATGVHLAARHPDLVRALVLLDPAIAIQ      120
121      PDRLADIAQRTLDEPDYPDVAAARRDKLASAWHDVAPRLLDAELDEHLVPTRPGRVGWRL      180
181      SLPAVTSYWGQLARPFVLPPAGLPTVLVQAMLVQPPFVTPAFRAALAERLGPALTIHEFD      240
241      CDHMVPLARPAETAALIRGLL                                             261

>MER0213832 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 68-307 ( active site residue(s): 156,245,302  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MRRLVSCSIAVLALCAALLTAPTAAAAPGSAILDVRPLGGRQLEVVVHSAAMNRPITLWM       60
61       SHPGPGAPALYLLNAVDGGEDGGPWMNRTDVAAFFADKNVNVIVPMGGRASYYTDWVADD      120
121      PVLGRNKWSTFLTAELPPLLEQRFGMTGRNAVAGLSMSATSALNLALDAPGRYQAVGAYS      180
181      GCARTSDPAGRALIYAELAVFGANATNMWGGPDSPLWAAHDPVLRAEELRGLAIYVSAGD      240
241      GRPGRHETLTAPGIDGNPLDLVERTVVGGLMETVIGACTRPLVDRLTSLAVPATLALRPG      300
301      THSWPYWQDDLHDSWPMFAAAIGA                                          324

>MER0042717 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-361 ( active site residue(s): 141,299,329  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSLADTLTLAARNAWALTFGPGVEAPEPTRSTVLWDAAHRELRRFERDEARDGAAAEGAD       60
61       PVLLVPPLAAPASCFDLRPDQSLARFLLGTGRTPYVVDYGEITFADRRMGFEDWINDILP      120
121      EAVLRTSADRDGAAVDLVGWSLGGTLALLTAAAHPQLPIGSITAVGSPLDYDRMTGMPQV      180
181      RAVAKLDGGLAVSTAVRAAGGIPAPLTRAAYRVTAWNRELTRPLFVASNIARTEALAKME      240
241      SIDRFMAQMPGYPGRFYGQLWGRLILNNDIGRGVLRLGGREIALAAVTAPVLLVGGPADV      300
301      ITPAPAVEAGTRTLTGAAFVRYETAPGSHLGILTGETARETTWTYLDEFLTEAAAVRESV      360
361      S                                                                 361

>MER0041209 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 80-448 ( active site residue(s): 203,325,427  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIRYDTTVEIDDAGPVAHTTHGRVRGVMDGPIAVWRSIPYAAPVTGPRRFRPAEPPEPW       60
61       DGVRECVRFGDIAPQTMGTMVPVDSELRMGEDCLWLNVWAPTEPREPEEPRPVLVWLHGG      120
121      AYCLGTAAQKIYDGRKLAETGDAVVVTVNYRIGVLGFLDLSSVVDGCTPNLGLHDQIRAL      180
181      EWVRENIAAFGGDPDNVTLFGESSGAGCVTALLTAPAAAGLFHKAIAQSPPATTVFGRQR      240
241      AELVAHRFLELLDLPPDRAAEVGELPIERLVQAAGVLFDEVPLREPGRLAAAPVVDGELL      300
301      PDYPITRFQQGRSHRVPLIIGTNKDEASLFRLFRSPIMPVTPEAVTIMLRDVAESHPDMS      360
361      PERVAEIASAYPDLGKARGALAMSTDAAFRMPAHWVADGHCTHSMTWVYRFDHATPMLRA      420
421      ARVGAGHATELPYVFGNFGTLNHDPTFWLGGRKQATEVSGRMMRRWLAFARHGVPAALDG      480
481      SKHWPPYDRDTRHTLLIDAIDRVVDDPDRDLHTAWGDQAVGFS                       523

>MER0038343 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 4-259 ( active site residue(s): 117,197,225  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVKYPEAQNFWHYRRMVFFDGARGRMHYRRWPVDSPLAVTVLLHGLGQHSGHYHRFARTL       60
61       RAVDVEVWGLDFAGHGLSEGDPEQPGTLAELVADATALVERVHAAHPDRPLLLMGHSLGA      120
121      VTALGMLGAAVPDTTSESDLNAVEASYPLTPSLPVAWLAGLVLSGVPRRALGGGAPGAPG      180
181      TPLPAQLPVLAVHGVEDRRAPVEGIRGWTARHESVDLREYAEAGHDLLHEPVQARVAADI      240
241      AEWMRAIVAAEAVVGSGRRH                                              260

>MER0041211 - family S9 non-peptidase homologues [S09.UNW] peptidase unit: 42-289 ( active site residue(s): 149,238,268  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRELNIPLPVLRAAINPLFRVMLNPRLPFTVQRTLMDAASRIQFVPAGTTVRRTRLGGRP       60
61       AEQLTAGRAEPTTAVLYLHGGGYAVGSMATHRSLAARLAHETGAAVFLLDYRLAPEHPFP      120
121      AALDDAVAAFDELVAAGYGPESIAIAGDSAGGGLSLATAQRLLAEQNRRPAALGLIAPWT      180
181      DPTGTPARERDLVVSRPWALACAAAYLGDGDPGVPGYAPLRASMHGLPPTYVQADIDELL      240
241      HEQCVELVQALRDAGVHVRFTESRGLWHVAQLQASLAAPAAAAVRELSEFLREALQPVDM      300
301      RHLG                                                              304

>MER0041201 - subfamily S1C unassigned peptidases [S01.UPC] peptidase unit: 245-411 ( active site residue(s): 261,298,378  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTESQHNGPVSDTRTAAGDTSDSAADRGNLRPPDAPVLGPRPVYRPHVDSHTAHAFRRP       60
61       AGQRGSFAERPPAPQTGDQAGDRLTQNRPPDAVLAEAFGRPEGSDELLQRDPDAADAAPA      120
121      PPAPADPWRDPNSGARLGAPAVATPQPEPLPASRKLTAREVLFGARVAPKALALLAAVAL      180
181      AIGVVGGLVGRLTAETSTNLTSRKVTLEQTESTDQPHGQIAQVANAVLPSVVSIRTTVGE      240
241      NGSTGSGVVIDGAGYIVTNNHVISMAAQDKSGRASIQVTFSDGSRVPANIVGRDPKTDLA      300
301      VLKVDVKNLTVARLGRSDDVQVGDDVLAIGSPLGLSKTVTSGIVSALHRPVKLSGEGSDT      360
361      NAVIDAVQTDASINPGNSGGALVDMDGQVIGINSAIRSETGGSVGLGFAIPVDTMTEVAQ      420
421      SLIRDGVMHHPMIGLSARTKTVANEVMSGAAVADVAPGGPADKAGIVEGDVIVKVGDREV      480
481      TGPEELTVAVQAREIGETVTVTLIRDGRQVDVPVTLESD                           519

>MER0041192 - acetylornithine deacetylase ArgE [M20.974] peptidase unit: 1-366 ( active site residue(s): 72,131 metal ligand(s): 70,101,132,160,340 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIDLSADPIALTAALVDIPSVSLDERAIADVVERALREQTTGFEVLRHGNVVLARTRRG       60
61       LPTRVILAGHLDTVPIADNVPSRFGTGPDGEQLLHGCGTVDMKSGDAVFLHLAATVTDPV      120
121      HDLTLIFYDGEEIAAEYNGLGHIERDLPEWLDGDLAVLGEPSGGWIEAGCQGTLRVRLRT      180
181      AGVRAHSARAWMGDNAIHRLAPVLARLADYRARQVDIDGCVYREGLSAVAVRGGVAGNVI      240
241      PDVGEVDVNFRFAPDRDLDQAIAHVREVFAGLEVEFEVTDAAPGALPGLTAPAAKALVES      300
301      VNAHGGGGVRAKYGWTDVSRFAARGIPAVNFGPGDPNLAHKRDEHVPTAQITAVTAMLRA      360
361      YLTGAV                                                            366

>MER0041233 - GYO_0385 g.p. ({Bacillus subtilis}) [S12.A23] peptidase unit: 113-290 ( active site residue(s): 113,116,204  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCLASRSSRGAGALKPTKYVATLWITLLLCAVAGTFGGTAQAAEWKHCAPPQGRQFETAT       60
61       PEEVGLDPAALQKVSELVANPTRLNFKIFRNGCLVVTGPANERTGALPWNLWSATKSVVS      120
121      LVAGIAADEGKLDLDAPIGEYLPAGLGDEAHRAILVRNLLTESSGIDVAIIAEGVTGVTG      180
181      LDANVVAQALGTPIEAPQGTKYGYSQRGVDLLAYVVAQAVGEDLQDYAQRTLFDPLGIDR      240
241      ADYHWARDRSGNTYGHAHLVLAPDDFAKLGLLVADRGRWGDRQVVSAAYLARASEPSPAM      300
301      KCWGFLFVVNGPGCGSEFAGLPADAVKMSGMLRQDNYIVPSLDLVVSWTGVTVPGSAVSY      360
361      PHDVLRAIGAAFRDPVLPDPGPYVPQPDVSLSDPRMSDPTATFAALGLGPYAYPGCDPVV      420
421      CLGKPLPPPFSDWPSGCIILGCFTPRPGD                                     449

>MER0041227 - family S12 unassigned peptidases [S12.UPW] peptidase unit: 89-246 ( active site residue(s): 99,102,189  ) (Nocardia farcinica) (Source: MEROPS) 
1        MNAPALISVAADLDSVTCFGPEDDPADAGLTHADVAAVWAAVQDWYRMGTTPAIQICLRR       60
61       QGRVVLNRAIGHGWGNAPKDGPDAEKVLITTDMPFCGFSTAKGVAAAVMAMLMEQGAFAP      120
121      GDRVADYLPGFAANGKERITIADVLSHSAGIPFVTPPYRGSELVVDEELALRALADLKPS      180
181      WPPGRFRVYHALTGGLIQRALVRAATGKRMRDHLAERVLTPLGFRWNNFGVAAQDVDRVV      240
241      PSVKTGPPASKVSVYLARRALGGRMDGAVSAQALRDFLTAELPSGNLVTTAAELSRFYEM      300
301      LARGGELDGVRVMRPETVRAAVRPAPWLPGVAGRVSRAGYELGGRRSKFGAHTEAHFGRS      360
361      GLTTQYGWADPARGLAGAVLTSGKARTDGDRPWRLVARISGRFGRIDPAERVFDL           415

>MER0041925 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 2-121 ( active site residue(s): 2  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCRHLGYVGAPVAVGELLTRGTHSLREQSWAPREMRGGGTINADGFGAAWWRPATDGVAV       60
61       SRYRNREPIWSDPAVTEVLGQLVSPAVLGSVRSATVGMPIERSACAPFTTGRWAFSHNGV      120
121      VPRWRQVLSAVSADLDVAATRSGATRLFETARLLDAEAATDAATLWVLLADLIASAESGG      180
181      YGDDPETAVRLLVEAVLRHEPAARLNFLLCDGTRLLATTVYHSLSALVTDEFAILSSEPY      240
241      DDDPRWQPIPDHCLVRAEPGRLAVEPLTGVPAAHTERPLA                          280

>MER0041267 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-283 ( active site residue(s): 94,228,256  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPTVELAAGRLHYVERGEGPPVVLLHGLLMNHTVWDEVLDLLPTGFRYVLPDLPLGAHPE       60
61       PLRPGVDLSLHGLNRLVAGFLAALDLRDVTLVHSDWGGALFLTAYGLDERVGGLIALPCE      120
121      AFGNFPPGLPGRMAVIATRVPGGVPLALRQLRIPWLRRSPLLFGWMARGGVSDELVRGWT      180
181      EPGLRDPGIRRDLLAYARSGFHQRELIANTEALRRFSGPALILWSSAGKVMPREHGRGLA      240
241      ELIPDARLVEIDDAYVLSMLDQPRAVAAAMGSFLLAHRAVSDR                       283

>MER0041224 - subfamily S9B unassigned peptidases [S09.UPB] peptidase unit: 46-306 ( active site residue(s): 157,256,285  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIPRANAGRRRAAQGEIRAVVRLCALVLHRERHLVARVHLCLTDSVPSASATTRIRTLDG       60
61       LHLAATLVTPEQPATHAVLLVHGGGVTREEGGFFTRLAAGLADVGIASLRFDLRGHGESE      120
121      GRQEELTLSSILNDIRVCLAHLRDATGAGELSLVGASFGGGICGYYTAKRPDELARLVLL      180
181      NPQFDYKKRTIDTRPYWTDDVINDEAARELNETGAIQFTPTLKHGRPLLNEVFWLRPNEV      240
241      LGEIKTPTLIVHGNADTLVPIDGSRAAVAQFTAPVELVEIDGSQHGFAVHDDPQYLNPKS      300
301      QEYQAEVIGIVSQWLRHQDVA                                             321

>MER0041200 - Htra2 peptidase ({Mycobacterium}-type) [S01.494] peptidase unit: 130-305 ( active site residue(s): 146,179,264  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTEDFQAAPQHANPQHPHGHYPTQPFSGPHPGMPAATPPPQAPARPARTGLVAAAVALAL       60
61       VSGGVGGAVGAVVTRSDDGRAPVTNALDAPKPSVSNVSNAPAGSTQAVAQKVLPSVVMIK      120
121      VASNRAEGEGSGVVLSSDGLILTNNHVASGGGTGARMEVHFADGSTAPATVVGADPVSDL      180
181      AVIKAQGRTDLTPIELGTSASLQVGQPVIAIGSPLGLAGTVTTGIVSALNRPVSTSGEGT      240
241      QNPNAPQPVIDAIQTDAAINPGNSGGALVDYEGKLIGINTAIATLGAGELGGQQSGSIGL      300
301      GFAIPVDQARRVADELIKTGQATYAQIGIKLRPQDTAALVLEATPGGPAAAAGIPAGAII      360
361      TKLDDRVIDSGEALIAAVRSHQPGDKVKVTYTDENGNNPKTVEVTLTGAPGDGGR           415

>MER0042188 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 318-484 ( active site residue(s): 459 metal ligand(s): 380,384,461 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNHRSTLAPGHRPRTGHRYRDDDQPFAPATESYAESSYTESSYAESGYRFAAPAAAATAA       60
61       GFGAQVEPEPHAAWHDGSAWTARDEQAAWNQGDWHQGEQPAWSQNDRAAWHQQEWDQQSA      120
121      WTEQDSWSRQDSWNQQASWSDGDAWGGEPTRSAVGATIADATAATESDPSQWQGACDNNA      180
181      WAQQPAQWTPGSEEPWTGNDWSGEPADEWTGDRDQRWTADDEADVAWDEPESPAAPAVIP      240
241      ARAGSRRGGAHRMPAPPTALKGRAAVVAVAAGAVVAAGQAAMASPQQPSQTIDYEAAGQI      300
301      HEIAAQSMSLEDPTASPDSPQVLNVSSPANIGQFGDMLEKGRKYAEELAAAEAAKLRPLF      360
361      AKFAAGNFTSGFGARWGVQHLGIDVAAPIGTPIYAVADGTVIEAGPASGFGMWVRLLHDD      420
421      GTVTVYGHIDTATVSAGERVLAGDQIATVGNRGFSTGPHVHFEVWLNGSDKVDPVPWLAT      480
481      RGISLGPQRD                                                        490

>MER0041222 - para-nitrobenzyl esterase ({Bacillus subtilis}) [S09.948] peptidase unit: 70-432 ( active site residue(s): 194,288,411  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVATIDITTADGVVRGRRGRRVLRWRALPYAAPPVGELRFRAPQPVQPWSGVRDATEFAS       60
61       ASFQHRGGARIGARTYQPTSEDSLTLNVIVPATPAITPRPVMVFIHGGGYVMGTSALGLY      120
121      SGARLALRGDVVVVTLNYRLGAFGYVDFSEFATPARPFDNNLGLRDQVAALEWVRRNIAA      180
181      FGGDPDNVTIFGESAGAHAVLALLATPAAHGLFHRGIAQSPPADWGLSAADAAEFARRLV      240
241      ERLGIDPADAARALTDLPANDIRRAADRAMAAAGRQRPGFFPICPVADGDYLPQAPVDAI      300
301      AAGTAAAVPLIIGTCRDEGQLFARFADYLPTNPDRLHRILSAEGDEVEKRVVAAYPGYPG      360
361      ARAAVRMGGDYVFWRPSVEVMEGHSRHAPTYAYRYDYAPRALQLAGIGATHATDLIPVFG      420
421      AADTPLGRALTAAGGARGLAAVTRQFQDNWLAFARTGTPLPSWPEYTEENRLTLIIDDPT      480
481      RVIGDPDRERRLAWSGVRVPTLT                                           503

>MER0140116 - homomultimeric peptidase [U56.001] peptidase unit: 27-257 (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MNNLHRELAPITSEAWAAIEEEAGRTFKRHIAGRRVVDVAGPHGVDFSAVGLGRTTGIAA       60
61       PDEGVQARQRVVAPLVELRVPFTLSREELDNVERGAKDTDLDAVKEAARRIAFAEDRAIF      120
121      EGYPAAGITGIRAAGSNAPITVPDDARLVPEAITQALTALRLAGVDGPYSVLLSAELYTE      180
181      VSETSDHGYPIRTHIERLIPDGEIIWAPAIDGAFVLTTRGGDYELTLGQDVSIGYLSHDA      240
241      DTVRLYFQQTMQFLVHTAEAAVALRR                                        266

>MER0041175 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 18-128 ( active site residue(s): 64,90,91  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTALDAIGPYEVLRFAPDTEIRFVGHEVGPVVTDSGVLALGVTHTFAETPAPQIVVVPGG       60
61       PAATAVAADTAVLDWLRAAHRTAEWTTSVCTGALVLAAAGLLDGKPATTHWAAQSALGLL      120
121      GAQPRKQERVVRADARIVTAAGVSAGIDMALWLVAEIHGADRARTVQLDIEYDPRPPVDA      180
181      GHPSKASSAVRRASMADQAKLMRALTAGELARTVTGAQLALWRGALRRVRARIG            234

>MER0041256 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-261 ( active site residue(s): 106,222,250  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRTSSRAADLDIVEGTLPLGLPYRALGSGPPLVFLRWFTPDHANPAGLMARAEIAALAPL       60
61       AAHRRVYAVNRAPDMPSGTTMAEIADDHAAALRTEFSAPVDVLGISSGGSVALQLAADHP      120
121      DVVRRLVVAASASRLEERARVAQLRYAEAAAAGKRALHHMEPEPRTVRARINAAVMWLLD      180
181      PLARPRNPADTLAFVRAEDAFDVTDRLAAITAPTLVIGGERDEFYSPAAFRRTADGIPDS      240
241      RLVIVPGAGHMGAVRHPRFAAEVLAFLDH                                     269

>MER0042363 - HtpX-2 peptidase [M48.004] peptidase unit: 75-292 ( active site residue(s): 137 metal ligand(s): 136,140,209 ) (Nocardia farcinica) (Source: UniProt Q5YPB8) 
1        MHGRGYANGLKTFGLMVGLSALIVFAGAMFRNTTILVVAILLAVGMNAWAYFNSDRIALR       60
61       AMHALPVSELEAPVMYRIVRELATAARQPMPRLYISPTNAPNAFATGRNPRHAAVCCTSG      120
121      ILQILDERELRAVLGHELSHVYNRDILISSIAGALAAVVSGLANLAFFAGAFGGRGNGEG      180
181      PSMLGVLLVSLLGPIAATLVKLAVSRSREYEADRSGAELTGDPLALASALRKLERGTQAA      240
241      PLPPEPQLTAQSHLMIANPFRAGERAARLFSTHPPMAERIARLEEMAGGRSGGYR           295

>MER0041279 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-273 ( active site residue(s): 100,224,252  ) (Nocardia farcinica) (Source: MEROPS) 
1        MATRDAVSADGTRIVYRVNGPEGARPLLLVHGWSADLTCWGAAADELARHYRVIAMDLRG       60
61       HGYSDIPDSGYDDPKNWAADVAAVLAAEAADTRAVLLGWSYGGIVVSDYLTAHGTDAVAG      120
121      VIYTGSMANIGVDVPGAEMGSALRQAIPGVFDESPGKAVRGFMAFGNANTGEGTDKGVDA      180
181      QRLFGMSLSTPPAVRKALFYRTVDNTETLRALDVPVLVLHGTADPVVPLANGRYVAETVP      240
241      TARTSFWEGAQHGLFIEDRARFVAEVREFVDGL                                 273

>MER0041285 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-328 ( active site residue(s): 143,285,316  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRAQLPAVLAQLPAKIAELLTAHRANLRARTYPTTALNPPTAQREVIPVTRPDGARLRVH       60
61       AYGPAGAPTIVLVHGWTCAIEYWNPQINAFAGDYRVVAYDQRGHGESERGTAPLTMDLLA      120
121      DDLAAVLDAAVPAGEKAVLVGHSLGGMTLQAWAARNPGEVTRRAHAVLLTNTAPHGLVDT      180
181      TTVVPFFNRPMRFKRTGVSLPLAVGKVGLGTPIVFPPVRPVRWLFARQVMCLACDSDRVD      240
241      FGMAIVRSCPAAVRAEFGKLLAVMDLGEAARNLVVPTTVLAGSCDDLTPPVHSELIAEML      300
301      ESVGSLDRYAVFETGHLGNVEMFERFNDELARVLDSVHSRRAEAVG                    346

>MER0041248 - repressor LexA [S24.001] peptidase unit: 106-216 ( active site residue(s): 140,177  ) (Nocardia farcinica) (Source: UniProt Q5YP21) 
1        MTDYDFEHLDTSALPVRQRRILEVIRDWVVEHGYAPSTRQIGAAVGLRSMSSVARHLRSL       60
61       EERGFLRRGEGVARPIDVRLFLHGTAAAAPSEDAVTVPVVGDIAAGAPILAEEHTDDLLT      120
121      LPRELVGRGTVFALRVRGDSMIDAAICDGDTVVVRSQREANSGDIVAAMIGEEATVKVFR      180
181      RRNGHVLLEPRNPAYDVIDGDEAVILGKVVSVLRRI                              216

>MER0042821 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 7-257 ( active site residue(s): 97,220,247  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLNTYRINGVEIGFDDQGYAPDRPAIVLLPGWGHDHRAFDRMLPHLRPHHRVIRVCWRGH       60
61       GIDRTLVGDFGVAEQVSDTIGLLDALEVERFVPLSHAHGGWAAMDIADTLGADRVPALLL      120
121      MDLIMTPPPPEFAAGLRALQDERTWRAAQRGLLDSWLAGSTDQAVLDHVRYEAGGHGFDM      180
181      WARSGRVIETAYATWGSPMGRLDKFTEPRPVRHVYSHPKSAEYDAVHAEFRRTHPWFSYT      240
241      RLDGHTHFPGIELPERVTTELFDLIGTQTPAT                                  272

>MER0041214 - hypothetical protein flj40219 [S09.958] peptidase unit: 63-398 ( active site residue(s): 184,343,377  ) (Nocardia farcinica) (Source: MEROPS) 
1        MDNVVEAPSGGWRGVVADGVRTFRGIRYARAERFAAPEPEPAHDGVIDASTRGPSAPQLP       60
61       SRLEAVMGAPAAFEQSEDCLRLTVTAPVQPPPGGSAVLVWLHGGAYLTGGGEWNLYDADR      120
121      LVRETGIVVVSVSYRLGVLGWLRAAGVSEGNLGLLDQLAALGWVRENIRAFGGDPARVTV      180
181      AGQSAGGQCVAAMVGMPRARGLFAQAIVQSAPFGIGFHDAAAAERAAAVFLAELGTDPRT      240
241      APVPELLAAQARTAIRRAGPGGLNAAPPFLPVEETDVLPGPAQWAAAVRAAPVPALVGCT      300
301      AAEMRAFFGGPHPVFGRVRRIPVAGPRMVTLAERVVGRKAFEDGVFRFADLLTDAGAVAR      360
361      CYRVGALHPGSPLGACHCIELPLLFGDPDDWRAAPMVRPTTPAELDELGARTRRSWGEFV      420
421      RTGAVADWPAHRHGSRAVRQLP                                            442

>MER0041202 - subfamily S1C unassigned peptidases [S01.UPC] peptidase unit: 85-251 ( active site residue(s): 101,132,216  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQDEPRGSGGRWSALLVAAVLALAGFLGFRGELPGWPFGDTGTTAAPTVRPPNPPLDQAA       60
61       VAAEVTPALVNISTRTRPLGQGAAGTGIVLTADGQVLTSHHVVKGAEQVVVTTQATGAEY      120
121      RATVLGYDSTADIALLSLPGANGLPTARLGSSSSVRVRDEVLALGNAGGTGGPPTATPGL      180
181      VTALNSTIVALNAADLSRKALRGMVEVAAPVSSGQSGGALVDWQGAVVGVVTASSGEAAA      240
241      ELERPNGYAVPIDTAMRVVRQIRSGIPTDTVHIGPTATLGVLISDASPSGARIDVALYGL      300
301      PAYAAGLADGEVIVSIDGRPIGSARVLRTAIDRRRPGETVRLGVLGVDGVERTVTVELGL      360
361      GTPN                                                              364

>MER0042784 - family M38 unassigned peptidases [M38.UPW] peptidase unit: 24-158 (Nocardia farcinica) (Source: MEROPS) 
1        MNAPTLVLDRCAVVTVDAAGTEYREGHVVVHGNRIGAVAAGPAPALDVPRIDGRGCLLTP       60
61       GLVNTHHHLYQWITRGIAADATLFEWLRTLYPIWAGIDEDAVRVAATGALAALARTGCTT      120
121      TADHHYLFPRTGGDLLGAEIAAAAAVGVRFHACRGSMDLGASDGGLPPDSVVERLDHILT      180
181      AGAEAIDRWHDPGFDAMVRIALAPCSPFSVTPDLLRESAALARSAGVRLHTHVAETRDEL      240
241      DYCRTRFGCTPVQYLEQLGWTGPDVWFAHAVHLDDTAVATLARTRTGVAHCPTSNGRLGA      300
301      GIARVPELVAAGVAVGLGVDGAASNEAAVMLEEPRHALLFARAAHGPRAMSVRRALELAT      360
361      MGGARVLGRAAEIGSIEPGKLADLALWRLDTAAHAGIEDPVTALILGAPPPLAALVVDGR      420
421      VIVRDGRVRTVDEAAVGREVAAAQAALLRAAR                                  452

>MER0041215 - subfamily S9A unassigned peptidases [S09.UPA] peptidase unit: 406-689 ( active site residue(s): 541,624,656  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSGVEQNVTDPYLWLEDVTDERALDWARAHNEVVAARFAATERFARLEQRILDMLDTDTK       60
61       IAYPGRRGRWLYNFWRDAEHPRGVWRRTTFAEYAQPSPDWDVLIDLDALADQEEENWVWG      120
121      GAAVLRPEQRRALISLSRGGADAKVVREFDIETRQFVAPEDGGFYLPEAKSEIRWIDADE      180
181      VYVGTDFGPGSLTDSGYPRIAKRWRRGTPLEQARTVFEGEPGDVAVSAGYDRTPGYERHF      240
241      VGRATDFFNEEVYLLDPDGTPRLLEVPTDASESWYKDWLLVRLRSPWEVGGTTYPTGALL      300
301      ATDFPSFLAGERRFDVLFTPDAHTSLHGYGWTENHLLLITLQDVQTKLHVLTPGADGWAI      360
361      EPLADTPPMATTSVINLDPLEGGDEFMLTTSGFTTPATLLAGSVGGPTTTLKQEPGFFDA      420
421      AGIETEQFFARSDDSTMVPYFVIRHRDRKGSPGPTVMSGYGGFEVSRTPAYSGASGMGWL      480
481      ERGGTWVMTNIRGGGEYGPEWHTSVQKANRHKVYEDFAAIARDLVARGITTPDQLGAVGG      540
541      SNGGLLMGVMLTRYPELFGAIVCQVPLLDMKRYHLLLAGASWMAEYGDPDKPEEWAYIRE      600
601      YSPYQNVRADADYPPILLTTSTRDDRVHPGHARKFAALLEEQGHTFWYHENIEGGHGGAA      660
661      DNKQMAFQAALIYEFFTQMLMERRTAARD                                     689

>MER0038357 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-286 ( active site residue(s): 118,234,265  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQTVPIQVPDGSTVPVRLIPAEGSHRHPVTPDAPRPVVVIMPGLGVPGAYYEAVARQLAR       60
61       RGFDAAIGELRGNGDSRPRPGPDSTYGYHELVSVDFPAIFEVVRSRFPASTPYLLGHSMG      120
121      GQLSVMYAARIRGRLGGLILVASGTPYYRGYRGLAAPGLLFGTTAAALTANLAGFWPGHR      180
181      ITVGGFGPQSKVLISDWARLARTGRFVPVGADIDYEERIARLKLPVLSITMTGDELTPPS      240
241      SARHLLDKMPAAEVTTWHQPEPLGHNGWIPDPVATVDRIEKWLRDR                    286

>MER0041210 - family S9 unassigned peptidases [S09.UPW] peptidase unit: 63-314 ( active site residue(s): 171,261,293  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPMSSDGSRPIPLPAVSRRRVLAAVVAVFAAAGCAAGERTAAPPSVVTTLAGPPPATPDA       60
61       PLRIAYGPDPDHIGDLYLPERGAAPYPVVVMVHGGGWSQWRDLDDTAGNSTALARHGVAV      120
121      WNIEYRRVRGGGGWPSTLADADDAVEALATVVQERSGHRLDLERVHVAGHSAGGHLAAWV      180
181      AGRHTLPPTAPGAQPRVRPRSATLMAGVFDLELAVTRGHDAFVRALLDGAPDEVPDRYRI      240
241      ASPIAHLPVGIRIDALHGDADQVVSIEQSRRYIAAARAAGDNAHLHELPGVTHADFLDVG      300
301      SPAWAAAQRVILHNIDTLD                                               319

>MER0041171 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 37-151 ( active site residue(s): 84,109,110  ) (Nocardia farcinica) (Source: MEROPS) 
1        METRTVHTAVYDTLADWEVGAAIAHINNPEWQRNPGSFEVRTVGLTRDPIRTKGGVRIVP       60
61       DLALGELTPEQSAGLILPGADTWVPGDLAPFAAAAAGFLDAGVPVAAICGATYGLAAAGL      120
121      LDTRKHTSNAPQFLAASGYAGADHYVEQPAVSDGVLVTATGTAPFEFAREVLRVLDVYEP      180
181      HVLDAWYRLFAHNDVSAFLALQDHAAAE                                      208

>MER0211603 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 3-254 ( active site residue(s): 98,225,254  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MHTVTSADGTAIAYEQIGAGTAGTVILVGGALEDRRSPKLTDLAAALAALDLTVLVYDRR       60
61       GRGDSGDTPGVYQAGHEIDDLAALVAAAGGAAALFGWSAGAVLALRAAASGRIPGLTRVV      120
121      AFEPPFVVDRTGHVPPQDAGTRLEQLLAEGKTGKAAAYYLRKVMGVPWTMVTTMRLTPYW      180
181      RTMKNLATSTAHDWAVIGPYTRGEALRPADWAELTVPVLVLAGTDSAASVKTAAAATAAA      240
241      LPLAHHRELPRLGHNQNVELIAAPTADFLTGKGAI                               275

>MER0042464 - subfamily M50B unassigned peptidases [M50.UPB] peptidase unit: 23-262 ( active site residue(s): 66 metal ligand(s): 65,69,192 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSLPFSRDRRLGRGAVRPSPVFLLVVAVTVAGAVLAWISDYGETAAGVGVFVLVVAGWIV       60
61       TLCLHEFAHAYLAWRAGDREVELRGYLTLNPLKYSHPLLSIVLPVVFIALGGFGLPGGAV      120
121      YVHPHAVSPARQRMISGAGPAVNAVCGVVLLLVVAVFGSTTGHAAFWYGLAFLGFLQITA      180
181      TLLNLLPIPGLDGYGILEPSLSYRTRRSLDQLKPLGMLLLFALILTPTVNRPFFDAIYTI      240
241      CELFGVPDVWVARGAGLVRFWT                                            262

>MER0041204 - subfamily S1E unassigned peptidases [S01.UPE] peptidase unit: 218-440 ( active site residue(s): 256,297,381  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLLPRIGRSRPAARQTRFRKSVIAASAAILLFGPTAAVANAEPAPATDLPAQLVEALNRD       60
61       LKLSPEEYLRRADLAQQVAAFATTAQRQYPQVFGGSWLDDAGKAIVALAQGPGAEEARAA      120
121      AESAGFEVRNVAKSEATLRGEKTAFERWLETQPEAVSALIRGVVIDTVNNSIAVRVDQPG      180
181      VPMPSFVDPSRVIVMTPPAAGEPVPQAGAIADELARGELAGGDGYTSVGGEGQLRCSFGF      240
241      NGTDRSGAVVNISAGHCNPDVASAGTPNAAAVHELLSGERNGGRLGVFQKSVLGSQDYSI      300
301      IKIDDAVTGRFANNGVRVPGAAPVRIEGVATPVVGAPVCKSGSRTGFSCGIVNAVDQTVQ      360
361      VGERELTQSFSANICALPGDSGGPIVTGRMALGISSASSVADYPMCAIPNLIGALTGNAP      420
421      QLFAQPVSVVLSDNPGLRIRTT                                            442

>MER0041286 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-252 ( active site residue(s): 85,211,240  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSVNHFRTGSGEPLVLVHGIGSRWQVWEPIIPLLAERFEVIAVDLPGFGGSAPLPRTTV       60
61       DTLTDALAEFLAAEGIERPHLAGNSMGGYITLRLGARGLARSVTAYSPIGFWDTPGRIWC      120
121      QQTLGNSVVLARVLKPVMPHLLGTAAGRTALLYLVFGRPWALDRQTAMDTAQGAADAPGF      180
181      REALASFTDVEFDEIGALADIPVTIAWGNRDVLLTYATQSRRARLALPTARHRTLFGSGH      240
241      TPFYDDPDTCARVLLEQFDPGPS                                           263

>MER0041280 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 1-520 ( active site residue(s): 193,460,487  ) (Nocardia farcinica) (Source: MEROPS) 
1        MMRTRLFRAVSALTAVGAVGASLLCAAATAAPGPVFGDCPEGAVTPGVGVRCAVVSVPMN       60
61       HAEPDGPRIELTVSRIAASGERRGALFTNPGGPGVDALDFWAQRLSTVPAELVEHYDLLA      120
121      VQPRGLRWATPLACAVDAAAPGQVSTTDEELKRACDAAQPGYLDTITTENTARDLDAVRA      180
181      ALGLDRIDYLGTSYGTYLGAVYATLFPDRVGRMVLDSNVHPGWIWTEEFAQQQAAGKQRM      240
241      DDLFGWIAERDAEYHLGSTPLQVYRTWVRLVSAQGGGWYANLTPPPASVADLPGDLPEPL      300
301      AEIARDGVNGTVEHLVKVQNFLRTLVSGGASAQVPLIGATSVATYTRAFWPTFAEAMAAA      360
361      NADPANVARLRAIAGATATDPTGRFVFSAITCNENAVPGRPELLGAAVGTIASGGNALDA      420
421      RADLVRSGMSCGTWKPVTTPVPIDGSGLATRPLLLQSRNDALTRYEGGPAMARALGGALV      480
481      TVEGGDHGTFGRGNPAVDEAVLTYLRTGEVNATVLPEAPLPG                        522

>MER0041167 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 32-140 ( active site residue(s): 56,103,115  ) (Nocardia farcinica) (Source: MEROPS) 
1        MGKHSLQRESRLPNSVKGALVMGAVAATGAMPAVPAMAATVNIPGLGDFDVPVPQEFEQP       60
61       VQQLNQQLQQALAAPQGGVQQAPLAAPQFPSFQIPAPFQQTTPGDIALDAAKTKVGAMYS      120
121      WGAAGPSTFDCSGLVKWAYRQAGIELPRTSFEQSHVGAPVAFEDLRPGDIVVTNGGGHVG      180
181      LYAGDGKLLNAVQSGQPVSYTPLRPDMVVTARRIAD                              216

>MER0041246 - family S16 unassigned peptidases [S16.UPW] peptidase unit: 531-811 ( active site residue(s): 702,745  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTTPRDLPVLFLTDPIVLPGMVVPIELDESAQAAIDAARAAGTDAVLLAPRLAEGYASYG       60
61       VIATIEQVGRMRGGAPAAVLKAERRAKIGHGVTGPGAALWVEAEPVETPPADGRTKELAA      120
121      EYKKLVVSVLQRREAWQLVDAVNQLTDASAIADTAGYAPYLTAEQKRELLETPDVAQRLT      180
181      VLIEWTKAYIAEAEVTEKISDEVRESMEKSQREFLLRQQLNAIRKELGEDEPDGADDYRT      240
241      RVEQADLPEAVREAALREVGRLERASDQSPESGWIRTWLDTVLELPWQVKTTDSTDISAA      300
301      RAVLDADHHGLDEVKDRMVEYLAVRARRAQRGLEVVGGRGSGAVLVLVGPPGVGKTSLGE      360
361      SVARALGRKFVRVALGGVRDEAEIRGHRRTYVGALPGRIVRAMKEAGSMNPVVLLDEIDK      420
421      VGSDFRGDPAAALLEVLDPAQNHTFRDHYLDLDLDLSDVLFIATANVMDTIPGPLLDRME      480
481      LITVDGYTEADKVAIARDFLVPRQLERNALTAEEVRITEAALREIAANYTREAGVRQMER      540
541      LIAKALRKAATRLTESASDPADSDSTVTPIRTGYDPELGYDEVVTDRGQTPLTIDVGDLK      600
601      EYLGRPRFTPDSVERTAVPGVATGLAVTGAGGDVLYIEANAAEGERSLTLTGQLGDVMKE      660
661      SAQIALTYVRSHLAEIGIEPSVLDRNIHIHFPAGAVPKDGPSAGVTMVTALVSLALGRQV      720
721      RADVGMTGEVTLNGRVLPIGGVKQKLLAAQRAGLKTVFIPARNEPDLDEVPAEVLAALDV      780
781      RPVADVADILAYAIEPVAEPAADGRPLAATA                                   811

>MER0461829 - subfamily C82A unassigned peptidases [C82.UPA] peptidase unit: 172-308 ( active site residue(s): 267,285  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006361) 
1        MDEVGGRHYTPMKCLARCVRAGDGMDEKPMHAASNDRPMPTHDRLTRRLRRGVLLSAAIA       60
61       AAGAVIVAPAQAEPLFPGLDSGSASAVTEPTPQANFAPPNINIADGETVGVAQPIIITFK      120
121      EPIEDRATAEKAIKITSSNEAPGHFYWWSDKQVRWRPNDFWPANTDVRVEAGGTTSSFRI      180
181      GDAQITTADDATKTITITRNGEVVKTMPTSLGKPGHETPNGTYIVGERHRQMVMDSSTYG      240
241      VPIDAPEGYKLDVEYATRLSNSGIFLHAAPWSVGQQGVANVSHGCLNVSTEDARWFFENA      300
301      QKGDPVIVQNTAGGTLNARDGLGDWN                                        326

>MER0041188 - Zmp1 peptidase ({Mycobacterium}-type) [M13.009] peptidase unit: 1-677 ( active site residue(s): 512,579 metal ligand(s): 511,515,575 ) (Nocardia farcinica) (Source: MEROPS) 
1        MGILDCVTSELTSPSGIDLSHLDESVRVQDDLFAHVNGKWLADHEIPADRAVDGAFRALY       60
61       DQAELDVQAIIQRCARDDQDDADARRIGDLYASFMDTDTVAAAGLSPISAELAAVRDVTD      120
121      RGAFAALLGRLARTGVGGAVGCYVDTDDKDSSRYLVHLTQSGLGLPDESYYRQDEFAEIR      180
181      TTYIAHIGRMFALAAADPRIGALLPQDPDTVGQRIFELERRLAAGHWDVVRRRDAELSYN      240
241      LTTFDALVAEQPEYDWAAWTSALAEGVDRDGPELFAEVVVRQPDYLRTFARLWAEADLAD      300
301      WQAWAAWRILRARAPYLTDELVEENFAFYGRTLTGATENRVRWKRGVSLVQELLGEAVGK      360
361      LYVAEHFPPAAKARMQELVANLQEAYRRNIAELDWMSPETRQAALAKLEKFTPKIGYPDR      420
421      WRDYSGVRIDPADLVGNYRRGYAAEHDRDLRKLGGPVDRDEWFMTPQTVNAYYNPGMNEI      480
481      VFPAAILQPPFFDMNADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNMVDWWTDADRA      540
541      EFAKRTKALIEQYNVLSPKDLPDEHTVNGEFTIGENIGDLGGLSIALEAYKISLNGAEPP      600
601      VIDGLTGLQRVFFGWAQVWRTKARAEEAIRRLAIDPHSPPEFRCNAVVRNIDSFHEAFDV      660
661      RPGDALYLDPAERVKIW                                                 677

>MER0055216 - subfamily M23B unassigned peptidases [M23.UPB] peptidase unit: 90-259 ( active site residue(s): 235 metal ligand(s): 156,160,237 ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006362) 
1        MPHHRMTSGSLSVKELLGEVTDEPRARHRMAADSTDRFKGVAGVAVAAGALLGTMAQAAP       60
61       ATAATTDLRAGGISDADADSDAAVSAAAPASTPATAPFGLGGLPDELAAPLAQAEQIIKD      120
121      LQTASPSVTAPAAAPAVLPVGREISSGYGSRWGAFHYGVDIADALGTPIRSAMGGTVIEA      180
181      GPASGFGQWVRVQQDDGTIAVYGHINEYYVQAGDRVSAGDVIAAVGNRGQSTGPHLHLEI      240
241      WDQDSNKIDPVAWLEGNGVLTEQRWGID                                      268

>MER0180749 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 249-348 ( active site residue(s): 264,318,330  ) (Nocardia farcinica) (Source: EMBL nucleotide NC_006362) 
1        MTAMKSPLKWAALALALLLIPVLIVAVFVDGDKDNPSFAQGKLATGTVPPEYEAWVIRAG       60
61       TMCEEISAPLIAAQIEQESNWNPNAVSPAGAQGLSQFMPYTWPSYGVDANGNGVISPFDP      120
121      PDAIMAQAKFDCTTVEQAKKDLASGRIKGDLIDIVLNAYNCGYGCVLANGGPQIVNGETE      180
181      GYAPGVKAKMAKYTQIGTGGGRVANCSQFRPGGGFGANVAAAALCWQGTPYAWGGGNIDG      240
241      PSLGIRDGGVADSHGDYGKVGFDCSGLVVYAVGQASGKTIQLPHYTTSILNDPRGREVAL      300
301      GDIQPGDIVFPGGGDPQHVGIAIGDGKMVEAPQSGDVVKISPLSNLGSGIEIRRFG          356